Recombinant Mouse Poliovirus Receptor/PVR Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11558P
Recombinant Mouse Poliovirus Receptor/PVR Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11558P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q91WP1 |
Synonym | CD155 CD155 antigen FLJ25946 HVED mE4 NECL 5 Necl-5 Necl5 Nectin like 5 Nectin like protein 5 Nectin-like protein 5 Ortholog of mouse Tage4 Poliovirus receptor PVR PVR_HUMAN PVS Taa1 Tage 4 TAGE4 |
Description | Recombinant Mouse Poliovirus Receptor/PVR Protein (Tagged) was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVA VFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATF PRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRIS WPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESL QELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMA GYNWSTTTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQ VHIIVKEKPENMQQNTRLHL |
Molecular Weight | 62 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. |