Recombinant Paramyxovirus SV5 Pk Protein
Beta LifeScience
SKU/CAT #: BLA-11568P
Recombinant Paramyxovirus SV5 Pk Protein
Beta LifeScience
SKU/CAT #: BLA-11568P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Parainfluenza virus 5 |
Accession | P11207 |
Synonym | Simian virus 5 SPV5gp2 V protein |
Description | Recombinant Paramyxovirus SV5 Pk Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHENLYFQGDPTDLSFSPDEINKLIETGLNTVE YFTSQQVTGTSSLGKNTIPPGVTGLLTNAAEAKIQESTNHQKGSVGGGAK PKKPRPKIAIVPADDKTVPGKPIPNPLLGLDSTPSTQTVLDLSGKTLPSG SYKGVKLAKFGKENLMTRFIEEPRENPIATSSPIDFKRGRDTGGFHRREY SIGWVGDEVKVTEWCNPSCSPITAAARRFECTCHQCPVTCSECERDTESG GGGSPGRRRRRRRRRRR |
Molecular Weight | 29 kDa including tags |
Purity | >90% SDS-PAGE.This protein was expressed in E. coli as inclusion bodies. The final product was refolded and chromatographically purified. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |