Recombinant pig Flt3 ligand / Flt3LG Protein
Beta LifeScience
SKU/CAT #: BLA-0931P
Recombinant pig Flt3 ligand / Flt3LG Protein
Beta LifeScience
SKU/CAT #: BLA-0931P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Accession | D2K7D6 |
Synonym | FL Flt 3 ligand Flt 3L Flt3 L FLT3 LG Flt3 ligand Flt3L FLT3L_HUMAN Flt3lg Fms related tyrosine kinase 3 ligand Fms-related tyrosine kinase 3 ligand SL cytokine |
Description | Recombinant pig Flt3 ligand / Flt3LG Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MSPDCSFPHSPISSTFANTIRQLSDYLLQDYPVTVASNLQDDELCGAFWR LVLAQRWMGQLKTVAGSQMQKLLEAVNTEIVFVTSCALQPLPSCLRFVQA NISHLLQDTSQQLVALKPWITRRNFSRCLELQCQPDPSTLLPPRSPGALE ATSLP |
Molecular Weight | 17 kDa |
Purity | >= 95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | OCI-AML5 cell proliferation. ED50 -‰¤ 5 ng/mL (-‰¥ 2.0 x 105 units/mg). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |