Recombinant Plasmodium Falciparum Gametocyte Surface Protein P230 (PFS230)
Beta LifeScience
SKU/CAT #: BLC-01020P

Greater than 90% as determined by SDS-PAGE.
Recombinant Plasmodium Falciparum Gametocyte Surface Protein P230 (PFS230)
Beta LifeScience
SKU/CAT #: BLC-01020P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Plasmodium Falciparum Gametocyte Surface Protein P230 (PFS230) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P68874 |
Target Symbol | PFS230 |
Species | Plasmodium falciparum (isolate 3D7) |
Expression System | E.coli |
Tag | Tag-Free |
Target Protein Sequence | YKEIHGCDFTGKYSHLFTYSKKPLPNDDDICNVTIGNNTFSGFACLSHFELKPNNCFSSVYDYNEANKVKKLFDLSTKVELDHIKQNTSGYTLSYIIFNKESTKLKFSCTCSSNYSNYTIRITFDPNYIIPEPQSRA |
Expression Range | 2980-3116aa |
Protein Length | Partial |
Mol. Weight | 15.9 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Gametocyte surface protein required for male/female gamete fusion. Also required for male gamete exflagellation and interaction with erythrocytes. |
Subcellular Location | Cell surface. Cell membrane. |
Database References | KEGG: pfa:PFB0405w |
Gene Functions References
- the identification, biochemical, biophysical, and immunological characterization of recombinant Pfs230 domains. PMID: 27432885
- Data show that anti-Pfs230 and Pf48/45 antibodies developed rapidly after exposure to gametocytes and were strongly associated with transmission-reducing activity. PMID: 21124765
- These results suggest that Pfs230 is the surface molecule on males that mediates RBC binding and plays an important role in oocyst development, a critical step in malaria transmission. PMID: 16879650