Recombinant Plasmodium Falciparum Reticulocyte Binding Protein 2 Homolog B (RH2B)
Beta LifeScience
SKU/CAT #: BLC-07465P
Greater than 85% as determined by SDS-PAGE.
Recombinant Plasmodium Falciparum Reticulocyte Binding Protein 2 Homolog B (RH2B)
Beta LifeScience
SKU/CAT #: BLC-07465P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Plasmodium Falciparum Reticulocyte Binding Protein 2 Homolog B (RH2B) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | C0H5F4 |
Target Symbol | RH2B |
Species | Plasmodium falciparum (isolate 3D7) |
Expression System | E.coli |
Tag | Tag-Free |
Target Protein Sequence | VKKQYIKTIEDVKFLLDSLNTIEEKNKSVANLEICTNKEDIKNLLKHVIKLANFSGIIVMSDTNTEITPENPLEDNDLLNLQLYFERKHEITSTLENDSDLELDHLGSNSDESIDNLKVYNDIIELHTYSTQILKYLDNIQKLKGDCNDLVKDCKELRELSTALYDLKIQITSVINRENDISNNIDIVSNKLNEIDAIQYN |
Expression Range | 1800-2000aa |
Protein Length | Partial |
Mol. Weight | 23.3 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | During the asexual blood stage, binds to a chymotrypsin sensitive, neuraminidase and trypsin resistant receptor on the surface of the host erythrocyte and thus is involved in merozoite invasion. The various processed forms have different binding affinities for the erythrocyte receptor; full length form binds with higher affinity followed by the 250 kDa form and finally the 300 kDa form while the 160 kDa form does not bind erythrocytes. After merozoite attachment and reorientation, RH2b binding to its erythrocyte receptor triggers an increase in intracellular Ca(2+) within the parasite resulting in the release of microneme proteins such as EBA175 which in turn leads to the formation of the tight junction between parasite and host cell.; During the asexual blood stage, binds to a trypsin-resistant and chymotrypsin and neuraminidase sensitive receptor on the surface of the host erythrocyte and thus is involved in merozoite invasion. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cytoplasmic vesicle, secretory vesicle, rhoptry. Cell junction, tight junction. Secreted.; [Reticulocyte-binding protein homolog 2b 85 kDa form]: Secreted. Cell membrane; Peripheral membrane protein; Extracellular side.; [Reticulocyte-binding protein homolog 2b 297 kDa form]: Secreted. Cell membrane; Single-pass type I membrane protein. |
Database References | KEGG: pfa:MAL13P1.176 |