Recombinant Rat Claudin-1 (CLDN1) Protein (His&Myc)

Name: Recombinant Rat Claudin-1 (CLDN1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-07623P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - transmembrane proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Claudin-1 (CLDN1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P56745
Target Symbol	CLDN1
Synonyms	Cldn1; Claudin-1
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	QWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATR
Expression Range	29-81aa
Protein Length	Partial
Mol. Weight	13.4 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions.
Subcellular Location	Cell junction, tight junction. Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Protein Families	Claudin family
Database References	KEGG: rno:65129 STRING: 10116.ENSRNOP00000002640 UniGene: Rn.24293
Tissue Specificity	Detected in epididymis (at protein level). Detected in testis and epididymis.

Gene Functions References

in Sertoli cells, testosterone acts through the receptor ZIP9 to trigger the non-classical signaling cascade, resulting in increased claudin expression and tight junction formation. PMID: 27164415
identified four claudin isoforms (1, 3, 5, and 12) and showed that their expression levels were regulated as a group by copper PMID: 27038183
Cardiotonic steroids may influence the formation of the blood-testis barrier via regulation of Cldn1 and Cldn11 expression. PMID: 25666991
siRNA knockdown of Rab3Gap1 prevented plasma membrane Claudin-1 expression and the formation of a barrier competent epithelium PMID: 23685254
Sodium butyrate enhanced intestinal barrier function through increasing Claudin-1 transcription via facilitating the association between SP1 and Claudin-1 promoter. PMID: 22684624
claudin-1 is the major sealing component in the perineurium, and could be modulated to facilitate drug delivery or, potentially, reseal the barrier under pathological conditions. PMID: 22733753
results confirm initiation of experimental periodontal disease is associated with reduction in expression of claudin-1 gene and protein. decreased level of critical tight junction protein may result in disruption of barrier function. PMID: 22092031
Sequential biphasic changes in claudin1 and claudin4 expression occur during the homing of rat CC531 CRC cells to the liver. PMID: 21388515
The blood brain barrier ultrastructure was disrupted and the expression of claudin-5 and claudin-1 decreased in the 4 and 72 h cerebral ischemia-reperfusion injury group respectively. PMID: 21626096
tight junction proteins Cldn 1,3 and 5 show altered distribution after intestinal ischaemia/reperfusion injury in rats PMID: 19929946
PATJ is mainly found at the tight junctions of paranodal loops, where it colocalized with claudin-1. PMID: 12403818
Claudin-1 was strongly detected at the proximal complex but it was weak at distal complex of late differentiating ameloblasts. PMID: 15052661
SP1 and SP3 bind to the Cldn1 promoter region, and that this interaction influences the expression of Cldn1 PMID: 17251524
That differential expression of claudin 1 has functional implications for bile formation. PMID: 18197414
increases at the distal portion of mature odontoblasts; may play an important role in the differentiation of odontoblasts PMID: 18208478
Claudin-6 is a transmembrane protein of tight junctions in podocytes during development and under pathological conditions. PMID: 18367650

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.