Recombinant Rat Factor D/CFD Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10298P
Recombinant Rat Factor D/CFD Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10298P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P32038 |
Synonym | Adipsin Adipsin/complement factor D Adn C3 convertase activator CFAD_HUMAN CFD Complement factor D complement factor D preproprotein D component of complement DF FactorD PFD Properdin factor D |
Description | Recombinant Rat Factor D/CFD Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDE VVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNA SLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIM DRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTW GSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA |
Molecular Weight | 30 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway. |
Subcellular Location | Secreted. |
Protein Families | Peptidase S1 family |
Database References |
Gene Functions References
- Adipsin is a biomarker of gastrointestinal toxicity mediated by a functional gamma-secretase inhibitor PMID: 12949072