Recombinant Rat Factor I/CFI Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10299P
Recombinant Rat Factor I/CFI Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10299P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | Q9WUW3 |
Synonym | AHUS3 ARMD13 C3b INA C3b inactivator C3B/C4B inactivator C3BINA CFAI_HUMAN Cfi Complement component I Complement control protein factor I Complement factor I Complement factor I heavy chain Complement factor I light chain F1 factor I FactorI FI I factor IF KAF Konglutinogen activating factor Light chain of factor I OTTHUMP00000219728 OTTHUMP00000221928 |
Description | Recombinant Rat Factor I/CFI Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | KNTPASGQPQEDLVEQKCLLKNYTHHSCDKVFCQPWQKCIEGTCACKLPY QCPKAGTPVCATNGRGYPTYCHLKSFECLHPEIKFSNNGTCTAEEKFNVS LIYGSTDTEGIVQVKLVDQDEKMFICKNSWSTVEANVACFDLGFPLGVRD IQGRFNIPVNHKINSTECLHVRCQGVETSLAECTFTKKSSKAPHGLAGVV CYTQDADFPTSQSFQCVNGKRIPQEKACDGVNDCGDQSDELCCKGCRGQA FLCKSGVCIPNQRKCNGEVDCITGEDESGCEEDKKNKIHKGLARSDQGGE TEIETEETEMLTPDMDTERKRIKSLLPKLSCGVKRNTHIRRKRVVGGKPA EMGDYPWQVAIKDGDRITCGGIYIGGCWILTAAHCVRPSRYRNYQVWTSL LDWLKPNSQLAVQGVSRVVVHEKYNGATYQNDIALVEMKKHPGKKECELI NSVPACVPWSPYLFQPNDRCIISGWGREKDNQKVYSLRWGEVDLIGNCSR FYPGRYYEKEMQCAGTSDGSIDACKGDSGGPLVCKDVNNVTYVWGIVSWG ENCGKPEFPGVYTRVASYFDWISYYVGRPLVSQYNV |
Molecular Weight | 66 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Trypsin-like serine protease that plays an essential role in regulating the immune response by controlling all complement pathways. Inhibits these pathways by cleaving three peptide bonds in the alpha-chain of C3b and two bonds in the alpha-chain of C4b thereby inactivating these proteins. Essential cofactors for these reactions include factor H and C4BP in the fluid phase and membrane cofactor protein/CD46 and CR1 on cell surfaces. The presence of these cofactors on healthy cells allows degradation of deposited C3b by CFI in order to prevent undesired complement activation, while in apoptotic cells or microbes, the absence of such cofactors leads to C3b-mediated complement activation and subsequent opsonization. |
Subcellular Location | Secreted, extracellular space. |
Protein Families | Peptidase S1 family |
Database References | |
Tissue Specificity | Expressed in the liver by hepatocytes. Also present in other cells such as monocytes, fibroblasts or keratinocytes. |