Recombinant Rat Vesicular Glutamate Transporter 2 (SLC17A6) Protein (His&Myc)

Name: Recombinant Rat Vesicular Glutamate Transporter 2 (SLC17A6) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06452P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - transmembrane proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Vesicular Glutamate Transporter 2 (SLC17A6) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9JI12
Target Symbol	SLC17A6
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS
Expression Range	499-582aa
Protein Length	Partial
Mol. Weight	17.1 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas.
Subcellular Location	Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Protein Families	Major facilitator superfamily, Sodium/anion cotransporter family, VGLUT subfamily
Database References	KEGG: rno:84487 STRING: 10116.ENSRNOP00000022383 UniGene: Rn.19372
Tissue Specificity	Expressed in brain (at protein level). Expressed in brainstem, deep nuclei, septal nuclei, nuclei of the diagonal band, frontal cortex, hypothalamus, midbrain, parietal cortex and temporal cortex. Also expressed in pineal gland and islets of Langerhans.

Gene Functions References

dual retrograde tract tracing was used in combination with fluorescence in situ hybridization (FISH) for VGLUT1 or VGLUT2 mRNA to identify the existence of VGLUT1 or VGLUT2 mRNA neurons that send collateral projections to both the thalamus and the parabrachial nucleus. PMID: 29650024
VGLUT2 was selectively up-regulated in ipsilateral spinal cord in a model of spared nerve injury. PMID: 27210824
Glutamate signaling that is mediated by VGLUT2 in the pulpal axons may be enhanced in the inflamed dental pulp, which may contribute to pulpal axon sensitization leading to hyperalgesia following inflammation. PMID: 25290694
These results suggest that VGLUT2 is localized in the afferent nerve terminals of the carotid body. PMID: 24906290
both VGluT1 and VGluT2 immunolabelings were found in ventral region of anterodorsal thalamic nucleus; many double-labeled axon terminals were also found in rostral part of the reticular thalamic nucleus and layers Ia and III-IV of the retrosplenial granular b cortex; some were also found in layer Ia of the retrosplenial granular a cortex PMID: 24639017
The results indicate that glutamatergic Vsp neurons sending their axons to the thalamic regions express VGLUT2. PMID: 23380804
This study demonistrated that Anterograde tracing from the vagus was combined with immunohistochemistry for VGLUT1 or VGLUT2 in medial nucleus tractus solitarii in the rat. PMID: 23897509
These results provide evidence for the involvement of VGLUT2 in the modulation of basal ganglia cicuits PMID: 24308494
Natural rewards and pain have distinct effects on the VGLUT expression pattern in the nucleus accumbens. PMID: 23835161
This study demonistrated that the estrogen receptor alpha protein in glutamatergic (vesicular glutamate transporter 2 immunoreactive) neurons of the female rat hypothalamus and amygdala. PMID: 23543101
VGLUT2-positive terminals make up 39.4% of excitatory thalamostriatal terminals. PMID: 23047588
BDNF stimulation upregulates the number, integrated density and intensity of VGLUT1 and VGLUT2 puncta in neurites of cultured hippocampal neurons (DIV7 PMID: 23326507
Amplification of VGLUT-2 expression after acoustic overexposure could be a compensatory mechanism from vestibular inputs in response to hearing loss and to a decrease of VGLUT-1 expression from auditory nerve fibers. PMID: 22570693
VGluT1 and VGluT2 are expressed in the periodontal Ruffini endings of the rat incisor. PMID: 21957077
Expressions of VGLUT2 mRNA are found in the olfactory epithelium, migratory cells and telencephalon during embryonic development. PMID: 21609737
The nocturnal elevation in VGLUT2 mRNA level in the pineal gland diminished under the constant light condition but persisted under the constant dark condition. PMID: 21982845
Data show that dopaminergic axons and terminals in the dorsolateral striatum and ventral striatum do not express VGluT1, VGluT2 or VGluT3, and suggest that in the normal, adult rat striatum, dopaminergic axons do not co-release glutamate. PMID: 21375596
These results suggest that most corneal afferents contain a neuropeptide or VGluT1/2, but rarely both. PMID: 20593358
trigeminal nucleus neurons expressing VGLUT1 and VGLUT2 project to the posteromedial ventral nucleus, but not to the posterior nuclei PMID: 20533365
The presence and co-localization of vesicular glutamate transporter 2 and PACAP in retinal ganglion cell and their projections in the brain, is described. PMID: 20339872
The phrenic nucleus (PhN) contained large numbers of VGLUT2-ir axon terminals, some of which made axosomatic and axodendritic synapses with PhN motoneurons. PMID: 20217347
The presence of two different subtypes of Vgluts, the size differences of the Vglut synaptic boutons, and their preference for different postsynaptic targets suggest that the action of glutamate on BF neurons may arise from multiple afferent sources. PMID: 19778580
results suggest a regression of the VGLUT2 phenotype of dopamine neurons with age, following normal development, lesion, or sprouting after injury, and a role for glutamate in the establishment of synapses by these neurons PMID: 19844994
Trigeminal ganglion neurons express VGluT2 more frequently than VGluT1; VGluT2 is coexpressed with VGluT1 in the cell bodies and axon terminals in most trigeminal ganglion neurons. PMID: 12815758
In the nucleus tractus solitarii there is a high density of VGluT2-immunoreactive fibers in the gelatinosus subnucleus and subpostremal area, and a moderate density in dorsolateral and medial subnuclei and central and lateral subnuclei. PMID: 14667459
The vesicular glutamate transporter 2 (VGLUT2)is a transmembrane protein responsible for loading glutamate into synaptic vesicles. PMID: 14677070
VGLUT1 and VGLUT2 transcripts are colocalized in most sensory neurons of the dorsal root ganglia, as well as in motor neurons of the ventral horn. PMID: 14681932
We found the majority of isolated dopamine neurons express VGLUT2, but not VGLUT1 or 3; our results provide a basis for the ability of dopamine neurons to release glutamate as a cotransmitter PMID: 15009640
data indicate that VGLUTs play a functional role in exocytotic glutamate release from astrocytes PMID: 15028755
VGLUT2 immunoreactivity was widespread in all spinal cord laminae, with higher intensities in LII and lateral LV, complementing VGLUT1 distribution. VGLUT2 immunoreactivity did not change after rhizotomy. PMID: 15065123
the major termination fields for GnRH-secreting axons, demonstrated the frequent occurrence of VGLUT2 immunoreactivity in GnRH axon terminals PMID: 15205380
A large population of VGLUT2-immunoreactive neurons is located primarily in the posterior division of the septum. PMID: 15224985
Presence of intense VGLUT2 immunoreactivity in neurons actively migrating from the olfactory placode suggests that this transporter is involved in the migratory process of these neurons. PMID: 15305861
VGLUT1 and VGLUT2, two subtypes of vesicular glutamate transporters, are expressed in rat spinal motoneurons. PMID: 15379996
the most likely sources of VGLUT2-positive boutons in the dentate supragranular layer, the CA2 area, as well as in the stratum lacunosum-moleculare of the CA1 field, might be the mossy cells PMID: 15382259
Vglut2 afferents to the medial prefrontal and primary somatosensory cortices. PMID: 15682395
The developmental pattern of Vglut2 in the olivary nucleus was studied. PMID: 15714284
Analysis of vGlut1 distribution in rat dorsal raphe nucleus reveals different populations of glutamate-containing axons innervating selective dendritic domains of serotonergic and non-serotonergic neurons suggesting they play different functional roles. PMID: 15845085
VGLUT1 and VGLUT2 proteins may often transport glutamate into vesicles within the same neuron, especially during early postnatal development, and that they are expressed widely in presumed glutamatergic, GABAergic, and cholinergic neurons, and astrocytes PMID: 15983996
Intracortical VGLUT1/VGLUT2 coexpressing neurons can independently modulate level of expression of either transporter at discrete synapses. May serve as plastic interface between subcortical thalamic input (VGLUT2) and cortical output (VGLUT1) neurons. PMID: 16079394
mRNA expressed expressed in thalamic neurons in mapping brain circuits. PMID: 16423326
The robust increase in vesicular glutamate transporter-2 mRNA and immunoreactivity after salt loading suggests that the cellular levels of vesicular glutamate transporter-2 in vasopressin neurons are regulated by alterations in water-electrolyte balance. PMID: 16481069
VGLUT2 was cocontained in small numbers of varicosities in laminae III-IV and IX. Anterogradely labeled spinocervical tract terminals in the lateral cervical nucleus were VGLUT2 immunoreactive. PMID: 16786558
These results indicate that vesicular glutamate transporter (VGLUT)2 is principally expressed in vasopressin neurons and also in some oxytocin neurons and that VGLUT2 in these neurons is involved in osmotic regulation. PMID: 16842872
VGLUT2 appears to possess two intrinsic transport machineries that are independent of each other: a DeltaPsi-dependent l-glutamate uptake and a Na(+)-dependent P(i) uptake PMID: 17046815
Neurosecretory neurons in the paraventricular, periventricular, supraoptic nuclei and the preoptic area secrete glutamate into the fenestrated vessels of the median eminence and posterior pituitary. PMID: 17175111
In accordance with current beliefs, we found significant expression of VGLUT2 mRNA in all the thalamic nuclei, while moderate expression of VGLUT1 mRNA was consistently found in both the principal relay and the association thalamic nuclei. PMID: 17299752
significant decline in the numbers of VGLUT2 immunoreactive boutons on the more distal dendrites of motoneurons in aged rats PMID: 17337147
Profiles containing both CRF- and either vGlut1- or vGlut2-immunoreactivity were apparent in the dorsal raphe nucleus PMID: 17825268
VGLUT2 is the only vesicular glutamate transporter expressed in thalamostriatal-projecting neurons located in the midline and intralaminar nuclei, whereas all neurons from the ventral thalamic nuclei innervating the striatum express both VGLUTs. PMID: 17826944

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.