Recombinant Rickettsia Conorii Outer Membrane Protein A (OMPA) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-08842P
Greater than 85% as determined by SDS-PAGE.
Recombinant Rickettsia Conorii Outer Membrane Protein A (OMPA) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-08842P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rickettsia Conorii Outer Membrane Protein A (OMPA) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q52657 |
Target Symbol | OMPA |
Synonyms | ompA; RC1273; Outer membrane protein A; 190 kDa antigen; Cell surface antigen; rOmp A; rOmpA) [Cleaved into: 120 kDa surface-exposed protein; 120 kDa outer membrane protein OmpA); 32 kDa beta peptide] |
Species | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Expression System | E.coli |
Tag | N-10His-SUMO&C-Myc |
Target Protein Sequence | DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF |
Expression Range | 1734-2021aa |
Protein Length | Partial |
Mol. Weight | 51.8kDa |
Research Area | Microbiology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Elicits protective immunity. |
Subcellular Location | [Outer membrane protein A]: Periplasm.; [120 kDa surface-exposed protein]: Secreted. Cell surface. Note=Surface exposed. This bacterium is covered by a S-layer with hexagonal symmetry.; [32 kDa beta peptide]: Cell outer membrane; Multi-pass membrane protein. Note=The cleaved C-terminal fragment (autotransporter domain) is localized in the outer membrane. |
Protein Families | Rickettsiae OmpA/OmpB family |
Database References | KEGG: rco:RC1273 |