Recombinant Salmonella typhi DNA-binding Protein HU-beta (His tag)
Beta LifeScience
SKU/CAT #: BLA-11588P
Recombinant Salmonella typhi DNA-binding Protein HU-beta (His tag)
Beta LifeScience
SKU/CAT #: BLA-11588P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Salmonella typhi |
Accession | P0A1R9 |
Description | Recombinant Salmonella typhi DNA-binding Protein HU-beta (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTF AVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN |
Molecular Weight | 29 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. |
Protein Families | Bacterial histone-like protein family |
Database References | KEGG: stt:t2409 STRING: 220341.STY0493 |