Recombinant Salmonella typhi uspA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11590P
Recombinant Salmonella typhi uspA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11590P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Salmonella typhi |
Accession | Q8Z268 |
Description | Recombinant Salmonella typhi uspA Protein (His tag) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLI DVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKK YDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Required for resistance to DNA-damaging agents. |
Subcellular Location | Cytoplasm. |
Protein Families | Universal stress protein A family |
Database References | KEGG: stt:t3925 STRING: 220341.STY4212 |