Recombinant Salmonella typhimurium PrgI Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11592P
Recombinant Salmonella typhimurium PrgI Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11592P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Salmonella typhimurium |
Accession | P41784 |
Description | Recombinant Salmonella typhimurium PrgI Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSK LSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
Molecular Weight | 25 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Required for invasion of epithelial cells. |
Protein Families | MxiH/PrgI/YscF family |
Database References | KEGG: stm:STM2873 STRING: 99287.STM2873 |
Gene Functions References
- analysis of structural and functional similarity between the bacterial type III secretion system needle protein PrgI and the eukaryotic apoptosis Bcl-2 proteins PMID: 19823588
- Thermodynamic characterization of the structural stability of the PrgI protein. PMID: 16501225
- analysis of electrostatic surfaces of the type III secretion needle proteins PrgI, BsaL, and MxiH PMID: 17617421