Recombinant Salmonella typhimurium Protein PrgJ (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11593P
Recombinant Salmonella typhimurium Protein PrgJ (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11593P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Salmonella typhimurium |
Accession | P41785 |
Description | Recombinant Salmonella typhimurium Protein PrgJ (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQT ITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLR S |
Molecular Weight | 16 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Required for invasion of epithelial cells. |
Database References | KEGG: stm:STM2872 STRING: 99287.STM2872 |
Gene Functions References
- The inner rod protein controls substrate switching and needle length in a Salmonella type III secretion system. PMID: 24379359