Recombinant Bovine Adiponectin (ADIPOQ) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10428P

Greater than 90% as determined by SDS-PAGE.
Recombinant Bovine Adiponectin (ADIPOQ) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10428P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bovine Adiponectin (ADIPOQ) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q3Y5Z3 |
Target Symbol | ADIPOQ |
Synonyms | ADIPOQ; ACRP30; APM1Adiponectin; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1 |
Species | Bos taurus (Bovine) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE |
Expression Range | 18-240aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 40.4kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. |
Subcellular Location | Secreted. |
Database References |
Gene Functions References
- These data suggest that energy balance around parturition may regulate plasma adiponectin but do not support roles for lipid mobilization or sustained changes in the plasma concentration of leptin, insulin, growth hormone, or fatty acids. PMID: 28843695
- Low level expression of adiponectin mRNA was found in all areas of bovine mammary gland tissues examined. AdipoR1 and AdipoR2 mRNAs were also detected in mammary tissues and their expression was particularly prominent in the parenchyma and cistern. PMID: 25676879
- Data suggest that genetic variation in promoter region of ADIPOQ (SNPs g.81966235C>T, g.81966377T>C, and g.81966364D>I) contribute to adiposity/marbling in skeletal muscle/meat (and thus meat quality) of Hanwoo beef cattle of North Korea. PMID: 25817801
- These data suggest differential contribution of adipose tissue depots to circulating adiponectin. PMID: 24462180
- Association analysis indicated that variable duplication within the ADIPOQ gene is associated with body measurements. PMID: 24341634
- 14 polymorphisms of the ADIPOQ gene were observed in Chinese cattle; 2 polymorphisms PR_-135 A>G and PR_-68 G>C were located in the core promoter region of ADIPOQ; 3 haplotypes in the 2 polymorphic sites were detected which produce effects on ADIPOQ transcription and are associated with growth traits PMID: 24099391
- reduced plasma adiponectin belongs to the subset of hormonal adaptations in EL dairy cows facilitating mammary glucose uptake via promotion of insulin resistance PMID: 23077076
- The physiologic status of the ovary has significant effects on the natural expression patterns of adiponectin and its receptors in follicular and luteal cells of bovine ovary. PMID: 20047754
- The disulfide bonds help to maintain the mature octadecameric adiponectin structure and stabilize intermediates during the assembly. PMID: 19943704
- Gobular adiponectin increased NO production in aortic endothlium by increasing NO synthase activity. PMID: 14551684
- A 5bp deletion mutation within the bovine ACRP30 gene was firstly detected and confirmed in 991 cattle . PMID: 18446445
- results indicate decreasing adiponectin sensitivity in adipose tissue after calving which might be involved in the reduced insulin sensitivity of adipose tissue during lactation PMID: 19345551
- Adiponectin gene was proved to be closely related to carcass and meat quality traits (P < 0.05), which can be used as a candidate molecular marker for production of high-grade meat in Qinchuan beef cattle. PMID: 19840922