Recombinant Human Cd70 Antigen (CD70) Protein (His)

Name: Recombinant Human Cd70 Antigen (CD70) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10853P
Price: 349.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Cytokines, Cytokines and growth factors, Featured cd protein molecules, Featured immune checkpoint protein molecules, Immune checkpoint proteins, Recombinant proteins, Recombinant proteins fall special offers - transmembrane proteins, Recombinant proteins holiday sale, Tumor necrosis factors and receptors (tnfs)

Price Save $121

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cd70 Antigen (CD70) Protein (His) is produced by our Yeast expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P32970
Target Symbol	CD70
Synonyms	CD 27L; CD 70; CD27 L; CD27 LG; CD27 ligand; CD27-L; CD27L; CD27LG; CD70; CD70 antigen; CD70 molecule; CD70_HUMAN; Ki 24 antigen; Ki24 antigen; Surface antigen CD70; TNFSF 7 ; TNFSF7; Tumor necrosis factor (ligand) superfamily, member 7; Tumor necrosis factor ligand superfamily member 7
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Expression Range	39-193
Protein Length	Extracellular Domain
Mol. Weight	19.1kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Subcellular Location	Membrane; Single-pass type II membrane protein.
Protein Families	Tumor necrosis factor family
Database References	HGNC: 11937 OMIM: 602840 KEGG: hsa:970 STRING: 9606.ENSP00000245903 UniGene: Hs.501497

Gene Functions References

This dose-escalation phase I trial provides evidence of good tolerability of ARGX-110, pharmacokinetics, and preliminary antitumor activity at all dose levels in generally heavily pretreated patients with advanced CD70-positive malignancies PMID: 28765328
Results show that CD70 promoter region methylation and expression are regulated by MBD4. Indeed, the study shows that downregulation of MBD4 contributed to overexpression and hypomethylation of the CD70 gene in CD4+ T cells from patients from systemic lupus erythematosus. PMID: 29018507
CD70 mitigates atherosclerosis at least in part by modulating macrophage function. PMID: 27786334
This study demonstrated that Expression of CD70 (CD27L) Is Associated With Epithelioid and Sarcomatous Features in IDH-Wild-Type Glioblastoma. PMID: 28789475
CD27 is engaged by CD70 cross-presented by other AML blasts or stem/progenitor cells in a paracrine manner. PMID: 28031480
human CD70-CD27 interactions therefore play a nonredundant role in T and B cell-mediated immunity, especially for protection against EBV and humoral immunity. PMID: 28011864
These data demonstrate the important role of the CD70/CD27 axis in immune responses in HTLV-1 carriers and ATL patients. PMID: 26077361
CD70: An emerging target in cancer immunotherapy PMID: 26213107
Both monomeric and trimeric forms of CD70 were detected in tumour cell membrane fractions, whereas cytoplasmic fractions contained almost exclusively monomeric CD70 PMID: 26671750
CD70 is overexpressed in systemic lupus erythematosus CD4+ T cells, but expression is not linked to the typical clinical and serological parameters associated with the disease. PMID: 24238281
CD70-blocking of alphaDC1s from both controls and patients with chronic lymphocytic leukaemia had a negative influence on the production of both IL-12p70 and the Th1 cytokine IFN-gamma. PMID: 24684541
CD70 acts as a functional receptor binding to soluble CD27, resulting in lymphoma progression and that immunotherapy using anti-CD70 antibody may be a potential candidate for treatment for NNKTL. PMID: 23206232
The mean expression of CD70 was almost twice as high in renal cell carcinoma relative to normal kidney tissue PMID: 22401771
Regulation of Langerhans cell CD70 expression is important in enhancing immunity against cutaneous epithelial pathogens and cancer. PMID: 22377764
Findings suggest that demethylation of CD70 promoter region contributes to the overexpression of CD70 in CD4+ T cells and may contribute to autoimmune response in systemic sclerosis (SSc). PMID: 22306512
These findings indicate that aberrant histone modifications within the TNFSF7 promoter may contribute to the development of lupus by increasing CD70 expression in CD4(+) T cells. PMID: 21865261
CD70 and CD11a facilitate the survival of T and B lymphocytes and indirectly enhance the destruction of platelets in immune thrombocytopenia. PMID: 21541792
data indicate that the virus-induced selective upregulation of CD70 by Langerhans cells is the critical feature that enhances their capacity to induce effector CD8+ T cell responses compared with virus-primed dermal dendritic cells that lack CD70 PMID: 21880979
concluded DNA methyltransferases(DNMTs) functioned as demethylases as MBD2, while increased DNMTs and MBD2 may cause demethylation and over expression of CD70 in CD4(+) T cells, potentially contributing to the pathogenesis of immune thrombocytopenia PMID: 21550117
Th1 cell-specific CD70 expression may be involved in an amplification loop for polarized Th1-type immune responses through T cell-T cell interactions. PMID: 21490618
Stimulation of T cells expressing CD70-specific chimeric antigen receptors resulted in CD27 costimulation and recognition of CD70-positive tumor cell lines and primary tumor cells, as shown by IFN-gamma and IL-2 secretion and by tumor cell killing. PMID: 21304103
RFX1 recruits SUV39H1 to the promoter regions of the CD11a and CD70 genes in CD4(+) T cells, thereby regulating local H3K9 tri-methylation levels. PMID: 21192791
In this review, CD27 and CD70 constitute a unique pair ligand and receptor pair which can activate innate and adaptive immunity as well as regulate immunity versus tolerance. PMID: 20699361
CD70 expression was significantly elevated and correlated with a decrease in CD70 promoter methylation in T4 lymphocytes from Sjogren's syndrome patients as compared to levels in controls. PMID: 20724115
Epigenetic silencing of the TNFSF7 gene via hypermethylation of its proximal region may allow the benign and invasive MCF10 variants to escape immune surveillance. PMID: 20119871
the CD70-CD27 interaction may play an important role in inducing effective immune responses in dendritic cell-based immunotherapy. PMID: 20201989
CD70 is an important factor in the regulation of B-cell growth and differentiation by plasmacytoid dendritic cells. PMID: 20139096
Data confirm previous observations of higher expression of CD70 in CD4+ T cells from patients with SLE, and suggest that increased Fyn protein content in CD4+ T cells can be associated with high SLE disease activity. PMID: 19955046
Identification of CD70-mediated apoptosis of immune effector cells as a novel immune escape pathway of human glioblastoma PMID: 11980654
intragraft gene expression is not a risk factor for acute cardiac allograft rejection PMID: 12009595
Systemic lupus erythematosus T cells and T cells treated with DNA methyltransferase inhibitors and ERK pathway inhibitors overexpress CD70. PMID: 15188362
Immunocytochemical analysis demonstrated that binding of an anti-CD70 antibody to CD70(TNFSF7), endogenously expressed on the surface of A498 and 786-O cell lines resulted in the rapid internalisation of the antibody-receptor complex. PMID: 16892042
Apoptosis mediated by exposure to the CD70 secreted by tumor cells may contribute to the failure of renal cell carcinoma patients to develop an effective lymphocyte-mediated antitumor response PMID: 17132225
reveal a novel role for non-Hodgkin lymphoma B cells in the development of intratumoral regulatory T cells PMID: 17615291
CD27-CD70 interactions in the pathogenesis of Waldenstrom macroglobulinemia. PMID: 18216294
CD70 gene was upregulated more than 1,000-fold and the enhanced expression of the CD70 molecule was confirmed by laser flow cytometry for various HTLV-1-carrying T-cell lines and primary CD4(+) T cells isolated from acute-type ATL patients. PMID: 18256142
Dendritic cells matured in the presence of PGE(2) induced the expression of OX40, OX40L, and CD70 on T cells facilitating T-cell/T-cell interaction that warrant long-lasting costimulation. PMID: 19029446
CD70 not only contributes to the activation of cytotoxic T cells in B cell precursor acute lymphoblastic leukemia but is a critical signal during the expansion phase of the cytotoxic T cell response. PMID: 19109206
Constitutive expression of CD70 transgene is sufficient to deregulate the CD8 T cell differentiation pathway of acute infection reminiscent of events in chronic infection. PMID: 19380782
Data showed that the CD70, perforin and KIR2DL4 promoters are demethylated in CD4(+)CD28(-) T cells, and that DNA methyltransferase 1 (Dnmt1) and Dnmt3a levels are decreased in this subset. PMID: 19394279

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.