Recombinant Bovine Granulocyte-Macrophage Colony-Stimulating Factor (CSF2) Protein (His-Myc)

Name: Recombinant Bovine Granulocyte-Macrophage Colony-Stimulating Factor (CSF2) Protein (His-Myc)
Brand: Beta LifeScience
SKU: BLC-07716P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Colony-stimulating factors and receptors (csfs), Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Bovine Granulocyte-Macrophage Colony-Stimulating Factor (CSF2) Protein (His-Myc) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P11052
Target Symbol	CSF2
Synonyms	Colony-stimulating factor Short name: CSF
Species	Bos taurus (Bovine)
Expression System	Yeast
Tag	C-6His-Myc
Target Protein Sequence	APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK
Expression Range	18-143aa
Protein Length	Full Length of Mature Protein
Mol. Weight	18 kDa
Research Area	Cytokine
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Subcellular Location	Secreted.
Protein Families	GM-CSF family
Database References	KEGG: bta:281095 STRING: 9913.ENSBTAP00000002054 UniGene: Bt.509

Gene Functions References

It was concluded that CSF2 can act as a developmental programming agent but alone is not able to abolish the adverse effects of in vitro production on fetal characteristics. PMID: 28379294
These results demonstrated that bovine colonic cells seem capable to respond to E. bovis merozoite I infection by the upregulation of CXCL10 and GM-CSF gene transcription. PMID: 25982572
Data suggest exposure to maternal CSF2 from D5-D7 of development is fundamentally different for female/male blastocysts with respect to embryo elongation, characteristics of transcriptome/methylome, and endometrial interferon tau secretion at D15. PMID: 25078682
inhibits induction of apoptosis in the bovine preimplantation embryo PMID: 21223422
The increase in calving rate caused by CSF2 treatment involves, in part, more extensive development of extraembryonic membranes and capacity of the conceptus to secrete IFNT2 at day 15 of pregnancy. PMID: 21339286
immunolocalization studies confirmed the presence of granulocyte-macrophage colony stimulating factor(GM-CSF) in the germ cell line in bovine and human testes and addition of GM-CSF enhances several parameters of sperm motility PMID: 12935848
the conceptus, through its secretion of IFN-tau, stimulates maternal epithelial expression of COX-2 and GM-CSF during the peri-attachment period in the cow. PMID: 13679318
CSF2 affect embryonic development and enhance embryo competence for posttransfer survival. PMID: 19797121

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.