Recombinant Bovine Insulin-Like Growth Factor Ii (IGF2) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-00521P
Greater than 85% as determined by SDS-PAGE.
Recombinant Bovine Insulin-Like Growth Factor Ii (IGF2) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-00521P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bovine Insulin-Like Growth Factor Ii (IGF2) Protein (hFc) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P07456 |
Target Symbol | IGF2 |
Synonyms | (IGF-II)(Erythrotropin) |
Species | Bos taurus (Bovine) |
Expression System | Yeast |
Tag | N-hFc |
Target Protein Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Expression Range | 25-91aa |
Protein Length | Partial |
Mol. Weight | 34.1 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver. Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate.; Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3. |
Subcellular Location | Secreted. |
Protein Families | Insulin family |
Database References |
Gene Functions References
- Methylation pattern in a CpG island of the IGF2 gene in cumulus cells from 1-3 mm and >/= 8.0 mm follicles and the effects of in vitro maturation on this pattern. PMID: 24174298
- Our results provide evidence that polymorphisms in the IGF2 gene are associated with growth traits, and may be used for marker-assisted selection in beef cattle breeding program PMID: 24374893
- The identification of the polymorphisms in the IGF2 gene that were significantly associated with growth traits in cattle. PMID: 23957672
- Polymorphisms in the IGF2 gene are associated with cattle growth traits. PMID: 23900197
- The LEP, IGF2 and CCL2 genes showed allelic expression imbalance in liver, kidney and pituitary glands of Polish Holstein-Friesian bulls. PMID: 23184004
- Sex-sorting procedure by flow cytometry did not affect the overall DNA methylation patterns of the IGF2 and IGF2R genes, although individual variation in their methylation patterns among bulls was observed. PMID: 22128039
- The reduction in IGFs mRNA level after 5 days of life in the duodenum (IGF-1 and IGF-2) and in the jejunum (IGF-1) was associated with reduction in villi length (duodenum and jejunum) and the increase of crypt depth (duodenum). PMID: 22439332
- Changes in the methylation pattern of IGF2 during in vitro maturation were different between incompetent and competent oocytes, and this characteristic may be useful as a molecular marker in studies of oocyte competence in cattle. PMID: 20833870
- Data describes the long-term changes to skeletal muscle growth and IGF1, 2, 1R, and 2R mRNA expression in progeny after exposure to high and low levels of maternal nutrient intake during the first two trimesters of gestation in the bovine. PMID: 21056085
- findings support work which suggests that the insulin-like growth factor 2 locus is an important biological regulator of milk production in dairy cattle PMID: 20822563
- effects of insulin, IGF-I and IGF-II on apoptosis and cell proliferation in bovine blastocysts in vitro PMID: 12112582
- IGF2 is subjected to extensive transcriptional regulation through multiple promoters, alternative splicing and polyadenylation, as well as genetic imprinting.IGF2 regulation is age-, tissue-, promoter-, and allele-specific PMID: 16120826
- Identification of a previously unknown differentially methylated region in exon 10 of the bovine IGF2 gene. PMID: 16644179
- Indel polymorphism associated with breeding value in bulls. PMID: 17242995
- The role of insulin-like growth factor 2 (IGF2) and the regulation of the IGF2 receptor (IGF2R) during follicular development were studied. PMID: 17360960
- Embryonic tissues from NT-derived embryos had higher expression of IGF-II mRNA than in vitro production embryonic tissues. PMID: 17628655
- The effect of single nucleotide polymorphisms in 6 genes and their associations with production factors in beef cattle are reported. PMID: 17785604
- study to assess the mRNA expression of IGF-I, IGF-II, IGF-IR and IGF-IIR in bovine oocytes and different stages of preimplantation embryos PMID: 19013732
- Dats detected that SNPs of IGF2 gene has close relationship with carcass and meat quality traits in Qinchuan cattle PMID: 19073573
- Hypomethylation trends in the intergenic region of the imprinted IGF2 and H19 genes in cloned cattle. PMID: 19282114
- Among embryos developing in vivo, the level of DNA methylation in the IGF2 intragenic DMR was significantly lower in female than in male blastocysts PMID: 19341790