Recombinant Bovine Interferon Gamma (IFNG) Protein (His)

Name: Recombinant Bovine Interferon Gamma (IFNG) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07214P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines, Cytokines and growth factors, Interferons and receptors (ifn), Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Bovine Interferon Gamma (IFNG) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P07353
Target Symbol	IFNG
Species	Bos taurus (Bovine)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	QGQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWKDESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
Expression Range	24-166aa
Protein Length	Full Length of Mature Protein
Mol. Weight	21.0 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Subcellular Location	Secreted.
Protein Families	Type II (or gamma) interferon family
Database References	KEGG: bta:281237 STRING: 9913.ENSBTAP00000016634 UniGene: Bt.188
Tissue Specificity	Released primarily from activated T lymphocytes.

Gene Functions References

Increase of cells expressing PD-1 and PD-L1 and enhancement of IFN-gamma production via PD-1/PD-L1 blockade in bovine mycoplasmosis. PMID: 28544524
The expression of multiple toll-like receptors, interferon-gamma, and interleukin-12 (IL-12) in cattle with low and high proviral loads of bovine leukemia virus are reported. PMID: 27473994
Diet-driven interferon-gamma enhances malignant transformation of primary bovine mammary epithelial cells through nutrient sensor GCN2-activated autophagy. PMID: 26962688
Data suggest that luteolytic factors (such as IFNG, tumor necrosis factor alpha, and PGF2a) control expression of MMP1, other matrix metalloproteinases, and tissue inhibitors of metalloproteinase in cultured luteal cells. PMID: 25924700
These findings indicate that IFN-gamma production correlates negatively and the production of antibodies against N. caninum is uncorrelated with plasma pregnancy-associated glycoproteins levels. PMID: 24456132
These results support pregnancy as type 2 immune response biased, with increases of IFN-gamma occurring after parturition and an increase in IL-4 production before calving. PMID: 23814356
Genetic characterization of IFNG gene was done in resistant and susceptible animals of Sahiwal cattle (n = 95) and Friesian (n = 92). PMID: 21960011
Data suggest that activation of gammadelta T cells to IFN-gamma production, NK cell-like killing plays a pivotal role in controlling virus infection. PMID: 21383249
The differential expression levels of IFN-gamma mRNA between cattle and buffalo could be due to a conserved 4 base (GTCT) deletion in the promoter region of buffalo. PMID: 20541234
SNPs in IFNG, IFNGR1 and R2, IL22, and IL22RA1 were analyzed for an association to Estimated breeding values for somatic cell score in Canadian Holstein bulls; no significant associations were found. PMID: 21328101
Nuclear localization sequence of bovine gamma-interferon provides translocation of recombinant protein to yeast Pichia pastoris cell nucleus PMID: 21268843
The upregulation of TNFRI mRNA expression by IFNG suggests that TNF and IFNG synergistically affect the death of luteal endothelial cells resulting in acute luteolysis PMID: 20562522
Data demonstrated that the monoclonal antibodies secreted by the four hybridoma cell lines could react specifically to the recombinant BovIFN-gamma. PMID: 17366886
The entire bovine IFN-gamma gene (BoIFNG) and 2605 bp of its promoter DNA were sequenced. A comprehensive survey for polymorphisms in the bovine IFN-gamma gene reveals a highly polymorphic intronic DNA sequence allowing improved genotyping of Bovinae. PMID: 12396714
Bovine interferon gamma demonstrates no effect on P-glycoprotein transport activity in human Caco-2 intestinal epithelial cells with rhodamine 123 as susbstrate. PMID: 15124210
In giant cell arteritis, IFN-gamma functional polymorphisms are associated with clinical manifestations of severity rather than susceptibility to this vasculitis. PMID: 15675129
The majority of patients with gad-enhancing lesions showed PLP/IFN gamma and MBP/IFN gamma recurrent burst responses PMID: 15957503
A polymorphism within the interferon gamma gene is a risk factor in severe acute respiratory syndrome susceptibility. PMID: 16672072
Intradermal sensitization of cows in the subclinical stage of M. paratuberculosis infection will upregulate expression of interferon gamma, enhancing the sensitivity of this assay. PMID: 17459831
This study compared the protective immune responses to bovine tuberculosis induced in cattle vaccinated with BCG Danish with those induced by BCG Pasteur. PMID: 17524495
Lipopolysaccharide stimulation up-regulates the secretion of cytokines by bovine polymorphonuclear neutrophil leukocytes. PMID: 17727806
Taken together, these results support the hypothesis of an inactivating phosphorylation of nNOS by IFNgamma, via JAK/STAT, in bovine chromaffin cells. PMID: 19141072
A tendency toward statistical significance for the effect of polymorphisms in the odds of infection in cattle was not found for alleles IFNG. PMID: 19525022

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.