Recombinant Chicken Interferon beta Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0836P
Recombinant Chicken Interferon beta Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0836P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Chicken |
Accession | Q90873 |
Synonym | beta-interferon Fibroblast interferon IFB IFF IFN beta IFN-beta IFNB IFNB 1 IFNB_HUMAN IFNB1 Interferon beta Interferon beta 1 fibroblast Interferon beta precursor MGC96956 |
Description | Recombinant Chicken Interferon beta Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKK QAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFV NQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCF RHVDTLIQWMKSRAPLTASSKRLNTQ |
Molecular Weight | 25 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Has antiviral activities. |
Subcellular Location | Secreted. |
Protein Families | Alpha/beta interferon family |
Database References |
Gene Functions References
- Fpv012 inhibits induction of IFNB. PMID: 23427153
- RNA interference-mediated knockdown of ChMda5 showed that ChMda5 plays an important role in the IFN response of chicken cells to dsRNA PMID: 21444763