Recombinant cynomolgus monkey CD137 Protein
Beta LifeScience
SKU/CAT #: BLA-11130P
Recombinant cynomolgus monkey CD137 Protein
Beta LifeScience
SKU/CAT #: BLA-11130P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | A9YYE7 |
Synonym | 4 1BB 4 1BB ligand receptor 4-1BB ligand receptor 4-1BB Ligand Receptor T Cell 4-1BB, mouse, homolog of Antigen 4-1BB Homolog CD 137 CD137 CD137 antigen CDw137 HLDA VI Homolog of mouse 4 1BB ILA Induced by lymphocyte activation induced by lymphocyte activation (ILA) Interleukin activated receptor homolog of mouse Ly63 Ly63, mouse, homolog of MGC2172 OTTHUMP00000044294 Receptor protein 4 1BB T cell antigen 4 1BB homolog T cell antigen ILA T-cell antigen 4-1BB homolog T-cell antigen ILA TNF receptor superfamily member 9 TNFRSF9 TNR9_HUMAN Tumor necrosis factor receptor superfamily member 9 |
Description | Recombinant cynomolgus monkey CD137 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFK TRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFG TFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSAT PPAPAREPGHSPQ |
Molecular Weight | 19 kDa |
Purity | >92% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Immobilized protein at 1μg/mL (100 µL/well), can bind Human 4-1BB Ligand, Fc Tag with a linear range of 0.01-0.5 ng/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |