Recombinant Cynomolgus monkey CRTAM Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-11138P
Recombinant Cynomolgus monkey CRTAM Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-11138P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | XP_005580021.1 |
Synonym | CD355 Class I MHC restricted T cell associated molecule Class-I MHC-restricted T-cell-associated molecule CRTAM CRTAM_HUMAN Cytotoxic and regulatory T cell molecule Cytotoxic and regulatory T-cell molecule |
Description | Recombinant Cynomolgus monkey CRTAM Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFK NSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLAT PFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTH HEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDL VTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQD PDLTTEANPQYLGLARKKSG |
Molecular Weight | 57 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |