Recombinant Defensin-like Protein 1 (Tagged)
Beta LifeScience
SKU/CAT #: BLA-0859P
Recombinant Defensin-like Protein 1 (Tagged)
Beta LifeScience
SKU/CAT #: BLA-0859P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Dahlia merckii |
Accession | P0C8Y4 |
Description | Recombinant Defensin-like Protein 1 (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC |
Molecular Weight | 20 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca(2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes. |
Subcellular Location | Secreted. |
Protein Families | DEFL family |