Recombinant Dog T-Cell Surface Glycoprotein Cd8 Alpha Chain (CD8A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06560P
Greater than 85% as determined by SDS-PAGE.
Recombinant Dog T-Cell Surface Glycoprotein Cd8 Alpha Chain (CD8A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06560P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Dog T-Cell Surface Glycoprotein Cd8 Alpha Chain (CD8A) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P33706 |
| Target Symbol | CD8A |
| Species | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression System | E.coli |
| Tag | N-10His |
| Target Protein Sequence | SGPSRFRMTPPKVVGQLHAQVELQCQVLLSTAAPGCSWLYQRNEPAARPVFLMYISQSRAKPAEGLDTKHISGQKKTDSTYSLTLSRFRKEDEGYYFCSVLSNSILYFSPFVPVFLPVKPPTTPAPRPPTRAPTNASKPVSPRGETCRPAAGSAVKTSGLDFACE |
| Expression Range | 22-186aa |
| Protein Length | Partial |
| Mol. Weight | 24.1 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Database References |
