Recombinant Dog TRAP/CD40L Protein
Beta LifeScience
SKU/CAT #: BLA-11127P
Recombinant Dog TRAP/CD40L Protein
Beta LifeScience
SKU/CAT #: BLA-11127P
Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Cytokines and growth factors, Featured cd protein molecules, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Dog |
Synonym | CD 40L CD154 CD40 antigen ligand CD40 ligand CD40 ligand, soluble form CD40-L CD40L CD40L_HUMAN CD40LG gp39 hCD40L HIGM1 IGM IMD3 T B cell activating molecule T BAM T-cell antigen Gp39 TNF-related activation protein TNFSF5 TrAP Tumor necrosis factor (ligand) superfamily member 5 Tumor necrosis factor ligand superfamily member 5 |
Description | Recombinant Dog TRAP/CD40L Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | MQKGDQDPRIAAHVISEASSNPASVLRWAPKGYYTISSNLVSLENGKQLA VKRQGLYYVYAQVTFCSNRAASSQAPFVASLCLHSPSGTERVLLRAASSR GSSKPCGQQSIHLGGVFELHPGASVFVNVTDPSQVSHGTGFTSFGLLKL |
Molecular Weight | 16 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |