Recombinant Horse Growth/Differentiation Factor 8 (MSTN) Protein (His)

Name: Recombinant Horse Growth/Differentiation Factor 8 (MSTN) Protein (His)
Brand: Beta LifeScience
SKU: BLC-06944P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Cytokines, Growth factors and receptors for advanced research, High-quality recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Horse Growth/Differentiation Factor 8 (MSTN) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9GM97
Target Symbol	MSTN
Species	Equus caballus (Horse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Expression Range	267-375aa
Protein Length	Full Length of Mature Protein
Mol. Weight	18.4 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Acts specifically as a negative regulator of skeletal muscle growth.
Subcellular Location	Secreted.
Protein Families	TGF-beta family
Database References	KEGG: ecb:100033832 STRING: 9796.ENSECAP00000018852 UniGene: Eca.12515

Gene Functions References

The association between a single nucleotide polymorphism and hypertrophy of muscle fiber in racehorses was studied. PMID: 29058242
identified several mitochondrial phenotypes associated with MSTN genotype in untrained Thoroughbred horses and in addition, our findings suggest that nutritional supplementation with CoQ may aid to restore coenzyme Q activity in TT/NN horses PMID: 29190290
The effect of an Equine Repetitive Element 1 insertion in the promoter of the myostatin gene, which is involved in muscle development, was also investigated. PMID: 26503543
Myostatin mRNA but not protein was increased in skeletal muscle of obese compared with lean animals. Myostatin mRNA was increased in crest fat of obese animals and protein was undetectable. Serum myostatin was higher in obese than lean animals. PMID: 25390640
All three target polymorphisms (Ins227bp, g.66493737 T succeeds C, BIEC2-417495) are suitable markers to assess the ability of non-elite Thoroughbreds to race at short or longer distances. PMID: 26100061
Genotype frequencies in Icelandic horses vary depending on whether the horses were used for meat or riding PMID: 26095686
The tissue-specific presence of myostatin, the moystatin receptor (activin receptor IIB, ActRIIB), follistatin and perilipin, genes and proteins across a range of equine tissues, were examined. PMID: 24956155
The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic). PMID: 25273961
The candidate for racing performance genomic region contained eight genes annotated by ENSEMBL, including the myostatin gene (MSTN). PMID: 21070273
Polymorphisms of the MSTN promoter region in 5 horse breeds in Poland are reported. PMID: 25403076
significant association observed between genotype and mRNA abundance for untrained horses with the C/C cohort having highest MSTN mRNA levels,T/T group lowest levels and C/T group intermediate levels; following training there was significant decrease in MSTN mRNA which was most apparent for the C/C cohort PMID: 22497477
Exon 2 of the MSTN gene, which encodes part of the TGF-beta pro-peptide, was sequenced in 332 horses of 20 different breeds and compared with the horse MSTN gene sequence deposited in GenBank. The sequences obtained revealed the presence of 11 haplotypes represented by 10 variable nucleotide mutations, eight of them corresponding to amino acid sequence changes. PMID: 22404361
Variation at the MSTN gene influences speed in Thoroughbred horses. PMID: 22016373
This study demonstrates that the g.66493737C>T single nucleotide polymorphism in MSTN provides the most powerful genetic marker for prediction of race distance aptitude in Thoroughbreds. PMID: 20932346
Characterized the horse (Equus caballus) MSTN gene and identified and analysed single nucleotide polymorphisms (SNPs) in breeds of different morphological types. PMID: 20706663

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.