Recombinant Horse VEGFA Protein

Name: Recombinant Horse VEGFA Protein
Brand: Beta LifeScience
SKU: BLA-2223P
Availability: InStock

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Equus
Accession	Q9GKR0
Synonym	Folliculostellate cell-derived growth factor Glioma-derived endothelial cell mitogen MGC70609 MVCD1 vascular endothelial growth factor Vascular endothelial growth factor A vascular endothelial growth factor A121 vascular endothelial growth factor A165 Vascular permeability factor Vegf VEGF A VEGF-A VEGF120 Vegfa VEGFA_HUMAN VPF
Description	Recombinant Horse VEGFA Protein was expressed in Yeast. It is a Full length protein
Source	Yeast
AA Sequence	APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSC VPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSK CECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQL ELNERTCRCDKPRR
Molecular Weight	19 kDa
Purity	>95% purity as determined by SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development.
Subcellular Location	Secreted.
Protein Families	PDGF/VEGF growth factor family
Database References	KEGG: ecb:100033839 UniGene: Eca.12648

Gene Functions References

Peripheral Blood-Derived Mesenchymal Stromal Cells Promote Angiogenesis via Paracrine Stimulation of Vascular Endothelial Growth Factor Secretion PMID: 25313202
TNF may up-regulate VEGF and stimulate angiogenesis in the mare early corpus luteum. PMID: 22492973

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.