Recombinant Human 4-1BBL Protein
Beta LifeScience
SKU/CAT #: BLA-10583P
Recombinant Human 4-1BBL Protein
Beta LifeScience
SKU/CAT #: BLA-10583P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P41273 |
Synonym | 4 1BB L 4 1BB ligand 4 1BBL 4-1BB ligand 4-1BBL Cd137l Cd157l Homolog of mouse 4 1BB L Homolog of mouse 4 1BBL ILA ligand (TNF related) Ly63l Receptor 4 1BB ligand TNF superfamily member 9 TNFL9_HUMAN Tnfsf9 TNLG5A Tumor necrosis factor (ligand) superfamily member 9 Tumor necrosis factor ligand 5A Tumor necrosis factor ligand superfamily member 9 Tumor necrosis factor superfamily member 9 |
Description | Recombinant Human 4-1BBL Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | LACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQ NVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLE LRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFG FQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL PSPRSE |
Molecular Weight | 27 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Recombinant Human 4-1BBL Protein binds to Human CD137 (4-1BB). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |
Target Details
Target Function | Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. |
Subcellular Location | Membrane; Single-pass type II membrane protein. |
Protein Families | Tumor necrosis factor family |
Database References | |
Tissue Specificity | Expressed in brain, placenta, lung, skeletal muscle and kidney. |
Gene Functions References
- CD137L-dendritic cells (CD137L-DCs) express high levels of adhesion molecules, display strong attachment. PMID: 27431276
- TNFSF9 exerts an inhibitory effect on hepatocellular carcinoma and may be a tumor suppressor. PMID: 28547807
- 4-1BB and 4-1BBL qualify as markers for prediction of patients' course and represent a valuable screening target for patients with acute myeloid leukemia at initial diagnosis. PMID: 27388616
- the results from this study show that the costimulatory 4-1BB ligand fortifies an antigen-rich melanoma cell line with enhanced antigen-specific stimulation of CD8 T cells PMID: 27564312
- the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated. PMID: 27430526
- blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation. PMID: 26872462
- CD137L is overexpressed in non-small cell lung cancer specimens and positive expression of CD137L was associated with better overall survival. PMID: 25631633
- In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells. PMID: 26125931
- vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer PMID: 25872647
- Elevated plasma levels and monocyte-associated expression of CD137 ligand in patients with acute atherothrombotic stroke PMID: 24899613
- Hence, the targeted combination of IL-15 and 4-BBL in the form of a trifunctional antibody-fusion protein is a promising new approach for cancer immunotherapy. PMID: 24198185
- monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline. PMID: 24639347
- TIRAP and IRAK2 are critical for the sustained inflammatory response that is mediated by late-phase signaling by the TLR-4-1BBL complex. PMID: 24084649
- this is the first study to indicate that this member of the TNF superfamily, CD137, is modulated by SAHA treatment in breast PMID: 22797667
- Data show that TNFR1 associates with CD137L and is required for CD137L reverse signaling. PMID: 23620528
- CD137L is a novel diagnostic marker of subtypes of non-Hodgkin B-cell lymphomas. PMID: 23095505
- signaling through CD137L in non-hematopoietic cells such as epithelial cells and endothelial cells has been shown to play an essential role in sterile inflammation by regulating immune cell recruitment. [Review] PMID: 22526397
- Stimulation of non-adherent PBMC with OVCAR-3 cells expressing 4-1BB ligand (4-1BBL) or IL-12 resulted in preferential expansion of the NK cell population. PMID: 22021067
- Data indicate that ex4-1BBL augments 4-1BB expression not only on the primed T cell, but also on DC. PMID: 21745658
- The expression of CD137L might play an important role in the development of laryngeal carcinomas. PMID: 20422976
- 4-1BBL and TRAF1 in the CD8 T cell response to influenza virus and HIV PMID: 21153322
- K562-MICA-4-1BBL-IL-15 cells would be developed for expansion of NK cells ex vivo and may have important implications for clinical immunotherapy. PMID: 20670353
- These data point to a hitherto unrecognized role of CD137 and CD137 ligand in multiple myeloma cell biology. PMID: 20520765
- TNFSF9 mRNA levels in peripheral blood mononuclear cells may be associated with primary biliary cirrhosis progression. PMID: 20303781
- Cocultures of Natural killer (NK) cells with CD137L transfectants confirmed that human CD137 inhibits NK-cell reactivity, while activating signals were transduced by its counterpart on NK cells in mice. PMID: 20008791
- the structure of the trimer of human 4-1BB ligand is unique among members of the tumor necrosis factor superfamily PMID: 20032458
- 4-1BBL and 4-1BB may have immunomodulatory functions, as shown by the anti-leukemia activity of MS-275 histone deacetylase inhibitor PMID: 19759901
- 4-1BBL provides a costimulatory signal for T cell activation, thereby allowing T cell expansion as well as cytokine production and the development of cytolytic effector function. PMID: 11994439
- Stimulation of 4-1BBL on DCs with 4-1BB-Fc or with 4-1BB-transfected Jurkat cells resulted in acquisition of capacity for the immature DCs to produce IL-12, suggesting that 4-1BBL may be an important mediator for maturation of CD11c(+) myeloid DCs PMID: 12590704
- 4-1 BB ligand can costimulate human CD28- T cells, resulting in cell division, inflammatory cytokine production, increased perforin levels, enhancement of cytolytic effector function, as well as the up-regulation of the anti-apoptotic protein Bcl-X(L). PMID: 12645943
- First evidence of expression and synthesis of CD137 and its ligand by human brain cells. PMID: 13130507
- Data show that reverse signaling via 4-1BB-ligand enhanced interleukin-12beta mRNA and the secretion of IL-12 p70 in various antigen-presenting cells, including monocytes. PMID: 14746806
- 4-1BB/4-1BBL and Fas/FasL pathways play important roles in vascular injury in Takayasu's arteritis. PMID: 14752253
- Data suggest that levels of soluble 4-1BB and 4-1BB ligand in sera at the time of diagnosis may be indicative of the severity and outcome of rheumatoid arthritis. PMID: 15031666
- trimeric CD137L (4-1BBL) requires cross-linking for its T cell co-stimulation activity PMID: 16204238
- Signaling through 4-1BB-L allows B cells to proliferate and the expression of its ligand, by the intra-tumoral mesh of follicular dendritic cells (FDC), could thus serve as a paracrine loop facilitating growth and survival of MCL cells PMID: 16287062
- Significantly lower CD137 ligand is associated with colorectal cancer patients PMID: 16596186
- Elevated plasma levels of 4-1BBL in multiple sclerosis patients may function as a self-regulatory mechanism of the 4-1BB/4-1BBL pathway involved in the disease process. PMID: 16970683
- Here we document a function for the TNF family member 4-1BB ligand (4-1BBL) in sustaining TLR-induced TNF production PMID: 17496895
- Reverse signalling by CD137 ligand is mediated by protein tyrosine kinases, p38 mitogen activated protein kinase (MAPK), extracellular signal-regulated kinase (ERK)1,2, MAP/ERK kinase (MEK), Phosphoinositide-3-kinase (PI3-K) and protein kinase A (PKA). PMID: 17855813
- selective immunosuppression through MSCs may perhaps occur partly through an increase in CD137L+ on T-lymphocytes PMID: 17972956
- T cells that had become non-responsive to anti-CD3 could be reactivated to proliferate when costimulated with 4-1BBL, either alone or combined with CD80/CD86. PMID: 17977894
- CD80 and 4-1BBL induce auto- and transcostimulation in tumor cells PMID: 18026115
- deliver new insights into the multiple effects of reverse signaling of CD137L in human DC during the initiation of an adaptive immune response PMID: 18395851
- PGE(2) induced the expression of the costimulatory molecules OX40L, CD70, and 4-1BBL on human dendritic cells. PMID: 19029446
- in cells costimulated with CD80/86 that had downregulated CD28 expression and ceased to proliferate, reactivation of proliferation by 4-1BBL costimulation also restored their CD28 expression PMID: 19217084
- (c)4-1BBL can be expressed on mononuclear blood cells in acute myeloid leukemia, myelodysplasia or non-Hodgkin lymphoma and can be coexpressed on lymphoid or myeloid malignant cells and on dendritic cells differentiated from AML-blasts. PMID: 19225975
- reverse signaling of 4-1BBL promotes the differentiation of potent T(h)1-inducing dendritic cells from human monocytes. PMID: 19684160