Recombinant Human Adiponectin/ADIPOQ Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-0051P
Recombinant Human Adiponectin/ADIPOQ Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-0051P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q15848 |
Synonym | 30 kDa adipocyte complement related protein 30 kDa adipocyte complement-related protein ACDC Acrp 30 ACRP30 ADIPO_HUMAN Adipocyte Adipocyte C1q and collagen domain containing protein Adipocyte complement related 30 kDa protein Adipocyte complement related protein of 30 kDa Adipocyte complement-related 30 kDa protein adipocyte-specific secretory protein Adiponectin Adiponectin precursor adiponectin, C1Q and collagen domain containing Adipoq Adipose most abundant gene transcript 1 Adipose most abundant gene transcript 1 protein Adipose specific collagen like factor ADIPQTL1 ADPN APM 1 apM-1 APM1 C1q and collagen domain-containing protein GBP 28 GBP28 Gelatin binding protein Gelatin binding protein 28 Gelatin-binding protein gelatin-binding protein 28 OTTHUMP00000210047 |
Description | Recombinant Human Adiponectin/ADIPOQ Protein (Animal Free) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGK FHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASG SVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
Molecular Weight | 17 kDa |
Purity | >90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The activity is determined by the ability to inhibit the proliferation of mouse M1 cells and is typically 1.0 - 2.5 μg/mL. This corresponds to an expected specific activity of 5.7 x 105 units/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |