Recombinant Human ADIPOR1 Protein
Beta LifeScience
SKU/CAT #: BLA-0058P
Recombinant Human ADIPOR1 Protein
Beta LifeScience
SKU/CAT #: BLA-0058P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | ACDCR1 ADIPO R1 Adiponectin receptor protein 1 ADIPOR 1 Adipor1 ADR1_HUMAN CGI 45 CGI 45 protein CGI-45 CGI45 CGI45 protein FLJ25385 FLJ42464 PAQR1 Progestin and adipoQ receptor family member I TESBP1A |
Description | Recombinant Human ADIPOR1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSF RACFKSIFRIHTETG |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |