Recombinant Human ANGPTL2/ARP2 Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-0061P
Recombinant Human ANGPTL2/ARP2 Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-0061P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9UKU9 |
Synonym | AI593246 Angiopoietin like 2 Angiopoietin related protein 2 Angiopoietin-like protein 2 Angiopoietin-related protein 2 ANGL2_HUMAN Angptl2 Arp2 AW260363 HARP MGC8889 UNQ170/PRO196 |
Description | Recombinant Human ANGPTL2/ARP2 Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MKHHHHHHASQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQ QRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEV DGGIVSEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRI LNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSARP VPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLT SLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD PGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGN YKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHN GKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRY QDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH |
Molecular Weight | 58 kDa including tags |
Purity | >95% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Induces sprouting in endothelial cells through an autocrine and paracrine action. |
Subcellular Location | Secreted. |
Database References | |
Tissue Specificity | Widely expressed in heart, small intestine, spleen and stomach. Also found in lower levels in colon, ovary, adrenal gland, skeletal muscle and in prostate. |
Gene Functions References
- examination of the potential sources of circulating ANGPTL2 and its common pathological properties associated with various chronic inflammatory diseases (review). PMID: 29138671
- Results showed that ANGPTL2 was highly expressed in glioma tissues and cell lines. Knockdown of ANGPTL2 reduced the proliferative and invasive abilities of glioma cells. PMID: 28247845
- REVIEW: ANGPTL2 autocrine/paracrine signaling is a new factor in accelerating heart disease development in the aging. Here, we focus on current topics relevant to ANGPTL2 function in heart disease. PMID: 28867689
- ANGPTL2 is a biomarker for liver fibrosis in chronic hepatitis B patients with normal to minimally raised ALT. PMID: 28962551
- ANGPTL2 was positively associated with aortic stiffness after kidney transplantation. PMID: 28158589
- Serum ANGPTL2 levels were significantly increased in non-small cell lung carcinoma patients, which could serve as a novel potential diagnostic and prognostic biomarker for NSCLC. PMID: 28164488
- Results reveal a novel cascade comprising sequential P. gingivalis lipopolysaccharide --> ANGPTL2 --> integrin alpha5beta1 --> inflammatory cytokine induction, which might be responsible for inducing potent periodontal disorganization activity in gingival epithelial cells. Via this pathway, ANGPTL2 functions in the pathogenesis of periodontitis and contributes to prolonging chronic inflammation in patients with systemi... PMID: 28934245
- In patients with type 2 diabetes, serum ANGPTL2 concentrations were independently associated with death and MACE. PMID: 27491833
- Elevated serum ANGPTL2 levels are a novel risk factor for the development of CVD in the general population. This association is partially mediated by metabolic disorders and inflammation. PMID: 27365403
- Increased ANGPTL2 expression contributes to proliferation and invasion of gastric cancer cells. PMID: 28058016
- Aberrant expression of ANGPTL2 in cumulus cells is potentially associated with impaired oocyte developmental competence in polycystic ovary syndrome. PMID: 26829602
- Reduced leukocyte DNA methylation in the promoter region of ANGPTL2 is associated with the pro-inflammatory environment that characterizes patients with post-ACS differently from age-matched healthy controls. Methylation of different CpGs in ANGPTL2 gene may prove to be a reliable biomarker of coronary disease PMID: 27101308
- At 11-13 weeks in pregnancies that develop GDM, the serum concentration of ANGPTL2 is increased, and it can be combined with maternal factors to provide effective early screening for GDM. PMID: 27647189
- ANGPTL2 and TGF-beta1 positively regulate each other as renal fibrosis progresses. PMID: 26806834
- ANGPTL2 may be a useful marker for detecting early postoperative recurrence in patients with gastric cancer. PMID: 26254352
- In lumbar spinal stenosis, Angptl2 promotes inflammation in ligamentum flavum(LF) tissue by activating IL-6 expression, leading to LF degeneration and hypertrophy. PMID: 25735609
- ANGPTL2 promotes adipose tissue macrophage and T lymphocyte accumulation and leads to insulin resistance. PMID: 26132105
- Serum ANGPTL2 in GC patients was significantly higher than for healthy controls. PMID: 26420253
- Angptl2 induces proinflammatory responses in peritoneal macrophages and monocytes. PMID: 26435501
- Serum ANGPTL2 concentration was associated with carotid atherosclerosis in patients with type 2 diabetes. PMID: 25889082
- these findings are the first to suggest a considerable role for Angptl2 in the pathogenesis of unstable coronary disease in a clinical context PMID: 25999029
- These results suggested that ANGPTL2 was a potential biomarker for gastric cancer. PMID: 25484242
- Serum ANGPTL2 improves preoperative detection of LN metastasis in CRC PMID: 25964566
- Serum ANGPTL2 is a novel diagnostic and recurrence-predictive biomarker in patients with colorectal cancer. PMID: 25294915
- ANGPTL2 may be important in the acquisition of androgen independency and tumor progression of prostate cancer in an autocrine and/or paracrine manner via the integrin alpha5beta1 receptor. PMID: 25370833
- Serum ANGPTL2 levels in patients with metastatic breast cancer were significantly higher than those in healthy subjects or in patients with ductal carcinoma in situ or non-metastatic invasive ductal carcinoma. PMID: 24585434
- abnormal upregulation of ANGPTL2 in colorectal cancer is associated with miR-25 downregulation PMID: 25174582
- This review aims at presenting an updated description of both the beneficial and deleterious biological properties of angptl2, in addition to its molecular signalling pathways and transcriptional regulation PMID: 25417860
- Results show that ANGPTL2 antagonizes apoptosis by increasing Syk expression in colorectal cancer cells resistant to chemotherapy. PMID: 25287946
- ANGPTL2 positively regulates endothelial colony forming cell vascular lumen formation. PMID: 24563071
- findings demonstrate that preventing ANGPTL2 signaling stimulated by the tumor microenvironment could inhibit tumor cell migration and metastasis PMID: 24448647
- expression of Angptl2 induced by mechanical stress in ligamentus flavum (LF) fibroblasts promotes LF tissue degeneration. PMID: 24465594
- Endothelial cell-derived Angptl2 accelerates vascular inflammation by activating proinflammatory signaling in endothelial cells and increasing macrophage infiltration, leading to endothelial dysfunction and atherosclerosis progression. PMID: 24526691
- Elevated serum Angptl2 is associated with the likelihood of CKD in the general population. PMID: 23739531
- Angptl2 levels are elevated in patients with type 2 diabetes with an independent association between increasing Angptl2 levels and increasing levels of albuminuria. PMID: 23602322
- periodic expression of ANGPTL2 is regulated by a molecular clock PMID: 23469106
- In epicardial adipose tissue from coronary heart disease patients, ANGPTL2 expression was positively correlated with that of TNF-alpha. PMID: 23333801
- Elevated serum ANGPTL2 levels were positively associated with the development of T2DM in a general population, independent of other risk factors including hs-CRP levels. PMID: 22966088
- ANGPTL-2 and -3 have enhancing effect on human hematopoietic progenitor cell survival, effects requiring the CC domain of the ANGPTL molecules. PMID: 21983347
- Macrophage-derived Angptl2 contributes to abdominal aortic aneurysm development by inducing inflammation and degradation of extracellular matrix in the vessel wall. PMID: 22556334
- tumor cell-derived ANGPTL2 drives metastasis and provided an initial proof of concept for blockade of its action as a strategy to antagonize the metastatic process. PMID: 22345152
- keratinocyte-derived Angptl2 functions in dermatomyositis pathogenesis by inducing chronic inflammation in skin tissue. PMID: 22281496
- Angptl2 acts as an important rheumatoid synovium-derived inflammatory mediator in RA pathogenesis PMID: 20304962
- The upregulation of ANGPTL2 in diabetic glomerulopathy shows a close relationship to abnormal microvasculature and endothelial inflammation. PMID: 17347581
- epigenetic silencing by hypermethylation of the ANGPTL2 promoter leads to a loss of ANGPTL2 function, which may be a factor in the carcinogenesis of ovarian cancer in a stage-dependent manner. PMID: 18593905
- Angiopoietin-like protein 2 (Angptl2) was secreted by adipose tissue and that its circulating level was closely related to adiposity, systemic insulin resistance, and inflammation in humans. PMID: 19723494