Recombinant Human ANGPTL2/ARP2 Protein (BSA and azide free)

Beta LifeScience SKU/CAT #: BLA-0061P

Recombinant Human ANGPTL2/ARP2 Protein (BSA and azide free)

Beta LifeScience SKU/CAT #: BLA-0061P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession Q9UKU9
Synonym AI593246 Angiopoietin like 2 Angiopoietin related protein 2 Angiopoietin-like protein 2 Angiopoietin-related protein 2 ANGL2_HUMAN Angptl2 Arp2 AW260363 HARP MGC8889 UNQ170/PRO196
Description Recombinant Human ANGPTL2/ARP2 Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MKHHHHHHASQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQ QRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEV DGGIVSEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRI LNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSARP VPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLT SLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD PGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGN YKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHN GKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRY QDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH
Molecular Weight 58 kDa including tags
Purity >95% Densitometry.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Induces sprouting in endothelial cells through an autocrine and paracrine action.
Subcellular Location Secreted.
Database References
Tissue Specificity Widely expressed in heart, small intestine, spleen and stomach. Also found in lower levels in colon, ovary, adrenal gland, skeletal muscle and in prostate.

Gene Functions References

  1. examination of the potential sources of circulating ANGPTL2 and its common pathological properties associated with various chronic inflammatory diseases (review). PMID: 29138671
  2. Results showed that ANGPTL2 was highly expressed in glioma tissues and cell lines. Knockdown of ANGPTL2 reduced the proliferative and invasive abilities of glioma cells. PMID: 28247845
  3. REVIEW: ANGPTL2 autocrine/paracrine signaling is a new factor in accelerating heart disease development in the aging. Here, we focus on current topics relevant to ANGPTL2 function in heart disease. PMID: 28867689
  4. ANGPTL2 is a biomarker for liver fibrosis in chronic hepatitis B patients with normal to minimally raised ALT. PMID: 28962551
  5. ANGPTL2 was positively associated with aortic stiffness after kidney transplantation. PMID: 28158589
  6. Serum ANGPTL2 levels were significantly increased in non-small cell lung carcinoma patients, which could serve as a novel potential diagnostic and prognostic biomarker for NSCLC. PMID: 28164488
  7. Results reveal a novel cascade comprising sequential P. gingivalis lipopolysaccharide --> ANGPTL2 --> integrin alpha5beta1 --> inflammatory cytokine induction, which might be responsible for inducing potent periodontal disorganization activity in gingival epithelial cells. Via this pathway, ANGPTL2 functions in the pathogenesis of periodontitis and contributes to prolonging chronic inflammation in patients with systemi... PMID: 28934245
  8. In patients with type 2 diabetes, serum ANGPTL2 concentrations were independently associated with death and MACE. PMID: 27491833
  9. Elevated serum ANGPTL2 levels are a novel risk factor for the development of CVD in the general population. This association is partially mediated by metabolic disorders and inflammation. PMID: 27365403
  10. Increased ANGPTL2 expression contributes to proliferation and invasion of gastric cancer cells. PMID: 28058016
  11. Aberrant expression of ANGPTL2 in cumulus cells is potentially associated with impaired oocyte developmental competence in polycystic ovary syndrome. PMID: 26829602
  12. Reduced leukocyte DNA methylation in the promoter region of ANGPTL2 is associated with the pro-inflammatory environment that characterizes patients with post-ACS differently from age-matched healthy controls. Methylation of different CpGs in ANGPTL2 gene may prove to be a reliable biomarker of coronary disease PMID: 27101308
  13. At 11-13 weeks in pregnancies that develop GDM, the serum concentration of ANGPTL2 is increased, and it can be combined with maternal factors to provide effective early screening for GDM. PMID: 27647189
  14. ANGPTL2 and TGF-beta1 positively regulate each other as renal fibrosis progresses. PMID: 26806834
  15. ANGPTL2 may be a useful marker for detecting early postoperative recurrence in patients with gastric cancer. PMID: 26254352
  16. In lumbar spinal stenosis, Angptl2 promotes inflammation in ligamentum flavum(LF) tissue by activating IL-6 expression, leading to LF degeneration and hypertrophy. PMID: 25735609
  17. ANGPTL2 promotes adipose tissue macrophage and T lymphocyte accumulation and leads to insulin resistance. PMID: 26132105
  18. Serum ANGPTL2 in GC patients was significantly higher than for healthy controls. PMID: 26420253
  19. Angptl2 induces proinflammatory responses in peritoneal macrophages and monocytes. PMID: 26435501
  20. Serum ANGPTL2 concentration was associated with carotid atherosclerosis in patients with type 2 diabetes. PMID: 25889082
  21. these findings are the first to suggest a considerable role for Angptl2 in the pathogenesis of unstable coronary disease in a clinical context PMID: 25999029
  22. These results suggested that ANGPTL2 was a potential biomarker for gastric cancer. PMID: 25484242
  23. Serum ANGPTL2 improves preoperative detection of LN metastasis in CRC PMID: 25964566
  24. Serum ANGPTL2 is a novel diagnostic and recurrence-predictive biomarker in patients with colorectal cancer. PMID: 25294915
  25. ANGPTL2 may be important in the acquisition of androgen independency and tumor progression of prostate cancer in an autocrine and/or paracrine manner via the integrin alpha5beta1 receptor. PMID: 25370833
  26. Serum ANGPTL2 levels in patients with metastatic breast cancer were significantly higher than those in healthy subjects or in patients with ductal carcinoma in situ or non-metastatic invasive ductal carcinoma. PMID: 24585434
  27. abnormal upregulation of ANGPTL2 in colorectal cancer is associated with miR-25 downregulation PMID: 25174582
  28. This review aims at presenting an updated description of both the beneficial and deleterious biological properties of angptl2, in addition to its molecular signalling pathways and transcriptional regulation PMID: 25417860
  29. Results show that ANGPTL2 antagonizes apoptosis by increasing Syk expression in colorectal cancer cells resistant to chemotherapy. PMID: 25287946
  30. ANGPTL2 positively regulates endothelial colony forming cell vascular lumen formation. PMID: 24563071
  31. findings demonstrate that preventing ANGPTL2 signaling stimulated by the tumor microenvironment could inhibit tumor cell migration and metastasis PMID: 24448647
  32. expression of Angptl2 induced by mechanical stress in ligamentus flavum (LF) fibroblasts promotes LF tissue degeneration. PMID: 24465594
  33. Endothelial cell-derived Angptl2 accelerates vascular inflammation by activating proinflammatory signaling in endothelial cells and increasing macrophage infiltration, leading to endothelial dysfunction and atherosclerosis progression. PMID: 24526691
  34. Elevated serum Angptl2 is associated with the likelihood of CKD in the general population. PMID: 23739531
  35. Angptl2 levels are elevated in patients with type 2 diabetes with an independent association between increasing Angptl2 levels and increasing levels of albuminuria. PMID: 23602322
  36. periodic expression of ANGPTL2 is regulated by a molecular clock PMID: 23469106
  37. In epicardial adipose tissue from coronary heart disease patients, ANGPTL2 expression was positively correlated with that of TNF-alpha. PMID: 23333801
  38. Elevated serum ANGPTL2 levels were positively associated with the development of T2DM in a general population, independent of other risk factors including hs-CRP levels. PMID: 22966088
  39. ANGPTL-2 and -3 have enhancing effect on human hematopoietic progenitor cell survival, effects requiring the CC domain of the ANGPTL molecules. PMID: 21983347
  40. Macrophage-derived Angptl2 contributes to abdominal aortic aneurysm development by inducing inflammation and degradation of extracellular matrix in the vessel wall. PMID: 22556334
  41. tumor cell-derived ANGPTL2 drives metastasis and provided an initial proof of concept for blockade of its action as a strategy to antagonize the metastatic process. PMID: 22345152
  42. keratinocyte-derived Angptl2 functions in dermatomyositis pathogenesis by inducing chronic inflammation in skin tissue. PMID: 22281496
  43. Angptl2 acts as an important rheumatoid synovium-derived inflammatory mediator in RA pathogenesis PMID: 20304962
  44. The upregulation of ANGPTL2 in diabetic glomerulopathy shows a close relationship to abnormal microvasculature and endothelial inflammation. PMID: 17347581
  45. epigenetic silencing by hypermethylation of the ANGPTL2 promoter leads to a loss of ANGPTL2 function, which may be a factor in the carcinogenesis of ovarian cancer in a stage-dependent manner. PMID: 18593905
  46. Angiopoietin-like protein 2 (Angptl2) was secreted by adipose tissue and that its circulating level was closely related to adiposity, systemic insulin resistance, and inflammation in humans. PMID: 19723494

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed