Recombinant Human ANGPTL3 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0066P
Recombinant Human ANGPTL3 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0066P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9Y5C1 |
Synonym | ANG 5 ANG-5 ANG5 Angiopoietin 5 Angiopoietin like 3 Angiopoietin related protein 3 Angiopoietin-5 Angiopoietin-like protein 3 Angiopoietin-related protein 3 ANGL3_HUMAN ANGPT5 ANGPTL3 ANL3 FHBL2 OTTHUMP00000010719 UNQ153/PRO179 |
Description | Recombinant Human ANGPTL3 Protein (His tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKG QINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNM SLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKT FVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIE |
Molecular Weight | 25 kDa including tags |
Purity | >95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |