Recombinant Human ANGPTL7 Protein
Beta LifeScience
SKU/CAT #: BLA-0013P
Recombinant Human ANGPTL7 Protein
Beta LifeScience
SKU/CAT #: BLA-0013P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O43827 |
Synonym | Angiopoietin like 7 Angiopoietin like factor Angiopoietin like factor (CDT6) Angiopoietin related protein 7 Angiopoietin-like factor Angiopoietin-like protein 7 Angiopoietin-related protein 7 ANGL7_HUMAN ANGPTL7 AngX CDT6 Cornea derived transcript 6 protein Cornea-derived transcript 6 protein dJ647M16.1 OTTHUMP00000001986 RP4-647M16.2 |
Description | Recombinant Human ANGPTL7 Protein was expressed in Insect cells. It is a Full length protein |
Source | Insect cells |
AA Sequence | QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVS VVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSAD AIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQR RKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDW EGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDK DNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWH GSTYSLKRVEMKIRPEDFKPHHHHHHHH |
Molecular Weight | 38 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its binding ability to recombinant vbeta3 integrin in a functional ELISA. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |