Recombinant Human APOA1BP Protein
Beta LifeScience
SKU/CAT #: BLA-0069P
Recombinant Human APOA1BP Protein
Beta LifeScience
SKU/CAT #: BLA-0069P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | AI BP AIBP ApoA I binding protein Apolipoprotein A I binding protein MGC119143 MGC119144 MGC119145 NAD(P)H hydrate epimerase NAD(P)HX epimerase YjeF N terminal domain containing protein 1 yjeF_N1 YJEFN1 |
Description | Recombinant Human APOA1BP Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTA LVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSI LSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTG RYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |