Recombinant Human APOBEC1 Protein
Beta LifeScience
SKU/CAT #: BLA-0072P
Recombinant Human APOBEC1 Protein
Beta LifeScience
SKU/CAT #: BLA-0072P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P41238 |
Synonym | ABEC1_HUMAN APOBEC 1 APOBEC1 Apolipoprotein B mRNA editing enzyme Apolipoprotein B mRNA editing enzyme catalytic polypeptide 1 Apolipoprotein B mRNA editing enzyme complex 1 Apolipoprotein B mRNA-editing enzyme 1 BEDP C->U-editing enzyme APOBEC-1 CDAR1 EC 3.5.4. HEPR |
Description | Recombinant Human APOBEC1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCII LSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |