Recombinant Human APOBEC3D Protein
Beta LifeScience
SKU/CAT #: BLA-0074P
Recombinant Human APOBEC3D Protein
Beta LifeScience
SKU/CAT #: BLA-0074P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | A3D ABC3D_HUMAN APOBEC3D APOBEC3DE APOBEC3E Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3D Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3E pseudogene ARP6 bK150C2.9 BK150C2.9 protein DNA dC >dU editing enzyme APOBEC 3D DNA dC->dU-editing enzyme APOBEC-3D hCG_41704 HCG41704, isoform CRA_b Probable DNA dC->dU-editing enzyme APOBEC-3D |
Description | Recombinant Human APOBEC3D Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLW DTGVFRGPVLPKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQI TWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRL HKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEI LRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGV FRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEV AEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFV SCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |