Recombinant Human APOF Protein
Beta LifeScience
SKU/CAT #: BLA-0080P
Recombinant Human APOF Protein
Beta LifeScience
SKU/CAT #: BLA-0080P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q13790 |
Synonym | Apo-F Apof APOF_HUMAN Apolipoprotein F DKFZp781G18150 Lipid transfer inhibitor protein LTIP MGC22520 |
Description | Recombinant Human APOF Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPKFL VSLALRNDALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRS TERNVSVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVHNVVQL LPGVGTFYNLGTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVS DLEETTTLASFISEVVSSAPYWGWAIIKSYDLDPGAGSLEI |
Molecular Weight | 58 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |