Recombinant Human APOL6 Protein
Beta LifeScience
SKU/CAT #: BLA-0084P
Recombinant Human APOL6 Protein
Beta LifeScience
SKU/CAT #: BLA-0084P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 2310076O14Rik APOL VI ApoL-VI APOL6 APOL6_HUMAN Apolipoprotein L VI Apolipoprotein L, 6 Apolipoprotein L-VI Apolipoprotein L6 APOLVI DKFZp667M075 FLJ38562 FLJ90164 MGC57495 |
Description | Recombinant Human APOL6 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLK EDLKGNIDKLRALADDIDKTHKKFTK |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |