Recombinant Human Apolipoprotein E4 / APOE4 Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-0105P
Recombinant Human Apolipoprotein E4 / APOE4 Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-0105P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P02649 |
Synonym | AD2 Alzheimer disease 2 (APOE*E4 associated, late onset) Apo E4 Apo-E APOE APOE_HUMAN apoe4 Apolipoprotein E Apolipoprotein E3 LDLCQ5 LPG MGC1571 |
Description | Recombinant Human Apolipoprotein E4 / APOE4 Protein (Animal Free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GPKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQ EELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQ AAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRL LRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSL AGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQ QIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDN H |
Molecular Weight | 34 kDa |
Purity | >= 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at room temperature. Store at -20°C. |