Recombinant Human BD2 Protein
Beta LifeScience
SKU/CAT #: BLA-0133P
Recombinant Human BD2 Protein
Beta LifeScience
SKU/CAT #: BLA-0133P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O15263 |
Synonym | BD 2 Beta defensin 2 DEFB 102 Defb 2 Defb 4 DEFB102 Defb2 Defb4 Defensin beta 2 Defensin beta 4 hBD 2 hBD2 mBD 2 mBD2 SAP 1 SAP1 Skin antimicrobial peptide 1 |
Description | Recombinant Human BD2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
Molecular Weight | 4 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Determined by the ability to chemoattract Human dendritic immature cells at a concentration of 10,000-100,000ng/ml corresponding to a specific activity of 10-100IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Please see notes section. |
Target Details
Target Function | Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells. |
Subcellular Location | Secreted. |
Protein Families | Beta-defensin family, LAP/TAP subfamily |
Database References | |
Tissue Specificity | Expressed in the skin and respiratory tract. |
Gene Functions References
- The encoded peptide has antimicrobial activity against E.coli, S. aureus, and P. aeruginosa. PMID: 9727055