Recombinant Human beta 2 Defensin/BD2 Protein
Beta LifeScience
SKU/CAT #: BLA-0142P
Recombinant Human beta 2 Defensin/BD2 Protein
Beta LifeScience
SKU/CAT #: BLA-0142P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O15263 |
Synonym | BD 2 BD-2 BD2 beta 2 beta 2 Defensin Beta defensin 2 Beta defensin 4B Beta-defensin 2 Beta-defensin 4A DEF B2 DEF B4 DEFB 102 DEFB 2 DEFB 4 DEFB102 DEFB2 DEFB2, formerly DEFB4 DEFB4, formerly DEFB4B DEFB4P Defensin Defensin beta 2 Defensin, beta 4 Defensin, beta 4, pseudogene Defensin, beta 4A Defensin, beta 4B Defensin, beta, 2, formerly Defensin, beta, 4, formerly DFB4A_HUMAN HBD 2 hBD-2 HBD2 mBD-2 SAP 1 SAP1 Skin antimicrobial peptide 1 Skin-antimicrobial peptide 1 |
Description | Recombinant Human beta 2 Defensin/BD2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
Molecular Weight | 4 kDa |
Purity | >98% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. Determined by its ability tochemoattract immature human dendritic cells using a concentration range of 10-100ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells. |
Subcellular Location | Secreted. |
Protein Families | Beta-defensin family, LAP/TAP subfamily |
Database References | |
Tissue Specificity | Expressed in the skin and respiratory tract. |
Gene Functions References
- The encoded peptide has antimicrobial activity against E.coli, S. aureus, and P. aeruginosa. PMID: 9727055