Recombinant Human beta 5 Defensin / BD5 Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-0145P
Recombinant Human beta 5 Defensin / BD5 Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-0145P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8NG35 |
Synonym | BD5 Beta defensin 105 precursor DEFB105 DEFB5 Defensin beta 105 |
Description | Recombinant Human beta 5 Defensin / BD5 Protein (Animal Free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQR I |
Molecular Weight | 6 kDa |
Purity | >98% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |