Recombinant Human BMPR2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-0187P
Recombinant Human BMPR2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-0187P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q13873 |
Synonym | BMP type II receptor BMP type-2 receptor BMPR 2 BMPR 3 BMPR II BMPR-2 BMPR-II Bmpr2 BMPR2_HUMAN BMPR3 BMPRII BMR 2 BMR2 Bone morphogenetic protein receptor type 2 Bone morphogenetic protein receptor type II Bone morphogenetic protein receptor type-2 Bone morphogenic protein receptor type II serine threonine kinase BRK 3 BRK3 PPH 1 PPH1 Serine threonine kinase type II activin receptor like kinase T ALK TALK Type II activin receptor like kinase |
Description | Recombinant Human BMPR2 Protein (Tagged) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGD INLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVN FTENFPPPDTTPLSPPHSFNRDETIVDDIEGRMDEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGKHHHHHH |
Molecular Weight | 42 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |