Recombinant Human BRAF (mutated G469 A) Protein
Beta LifeScience
SKU/CAT #: BLA-0195P
Recombinant Human BRAF (mutated G469 A) Protein
Beta LifeScience
SKU/CAT #: BLA-0195P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P15056 |
Synonym | FLJ95109 94 kDa B raf protein B raf B raf 1 B Raf proto oncogene serine threonine protein kinase B Raf proto oncogene, serine/threonine kinase B RAF1 B-Raf proto-oncogene serine/threonine-protein kinase (p94) BRAF BRAF 1 BRAF_HUMAN BRAF1 cRmil MGC126806 MGC138284 Murine sarcoma viral (v-raf) oncogene homolog B1 Murine sarcoma viral v raf oncogene homolog B1 NS7 Oncogen BRAF oncogene BRAF1 p94 Proto-oncogene B-Raf Proto-oncogene c-Rmil RAFB 1 RAFB1 RMIL Serine/threonine-protein kinase B-raf v raf murine sarcoma viral oncogene homolog B v raf murine sarcoma viral oncogene homolog B1 v-Raf murine sarcoma viral oncogene homolog B1 |
Description | Recombinant Human BRAF (mutated G469 A) Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | DLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSS SSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFATVYKGKWHGDV AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQ WCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSN NIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDK NPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSK VRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASE PSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH |
Molecular Weight | 69 kDa including tags |
Purity | >80% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity of this protein was determined to be 2,200 nmol/min/mg. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |