Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08417P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08417P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O00175 |
Target Symbol | CCL24 |
Synonyms | C C motif chemokine 24; C-C motif chemokine 24; CCL24; CCL24_HUMAN; Chemokine CC Motif Ligand 24; CK beta 6; CK-beta-6; Ckb6; Eosinophil chemotactic protein 2; Eotaxin-2; MPIF 2; MPIF-2; MPIF2; Myeloid progenitor inhibitory factor 2; SCYA24; Small inducible cytokine A24; Small inducible cytokine subfamily A (Cys-Cys) member 24 ; Small-inducible cytokine A24 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
Expression Range | 27-119aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 14.5kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References | |
Tissue Specificity | Activated monocytes and activated T lymphocytes. |
Gene Functions References
- Study showed that CCL24 was upregulated in hepatocellular carcinoma (HCC) tissues and correlated with poor prognosis in HCC patients . Also, CCL24 was associated with the metastatic potential of HCC cell lines and promoted proliferation, migration, and invasion. PMID: 28042950
- Mean eotaxin 2 concentrations in nasal fluid in patients with perennial allergic rhinitis and nonallergic and allergic chronic rhinosinusitis with nasal polyps patients were significantly higher in comparison to control subjects. PMID: 28587510
- HMGB1 did not elicit chemotaxis of human eosinophils alone and had no effect in combination with the eosinophil chemotactic agent, eotaxin-2 (CCL24). PMID: 25774667
- these data suggest that CCL26 and CCL24 are likely involved in the pathogenesis of chronic nasal hypereosinophilia, with a complex cooperation and different involvement of the various members of eotaxin family. PMID: 24989688
- Pregnancy associated environments increased local CCL24/CCR3, supporting the process of decidualization in human early pregnancy. PMID: 23696919
- Phosphodiesterase 4 inhibitors, rolipram and RO-20-1724 have no effect on CCL24 expression in human primary bronchial epithelial cells. PMID: 22946025
- Study shows that CCL24 levels were significantly increased in age-related macular degeneration (AMD) patients despite Avastin treatment as compared with normal controls and those without Avastin. PMID: 23025269
- CCR3 is differentially expressed on inflammatory cells in rheumatoid arthritis, while eotaxin-2, a potent CCR3 agonist, is differentially expressed in active disease. PMID: 20659406
- stimulates lung fibroblast proliferation and collagen synthesis PMID: 20143648
- alters eosinophil integrin function via mitogen-activated protein kinases PMID: 12034562
- Intradermal injection of CCL24 induces recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions in atopic and nonatopic volunteers. PMID: 12193745
- Plasma eotaxin-2 concentrations differed in asthmatic patients with respect to aspirin intolerance and tolerance, indicating that eotaxin-2 may be differentially up-regulated according to aspirin intolerance. PMID: 16304252
- Our results suggest that Eo2 +179T>C and Eo2 +275C>T of eotaxin-2 might be associated with the susceptibility of ulcerative colitis. PMID: 16391516
- These data support the idea that CCL24/eotaxin-2 is part of the mechanism of CD4 lymphocyte activation paracrinally induced by Nef. PMID: 17630924
- eotaxin-2 is a chemokine strongly associated with primary and metastatic tumors of colorectal origin PMID: 17908961
- the ability to produce eotaxin-2/CCL24 is acquired during the differentiation into eosinophilic lineage which is dependent on GATA-1 expression PMID: 17917245
- This protein is an eosinophil chemoattractant that is up-regulated by human rhinovirus infection in cultured bronchial epithelial cells. PMID: 11467997