Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08417P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08417P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human C-C Motif Chemokine 24 (CCL24) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb O00175
Target Symbol CCL24
Synonyms C C motif chemokine 24; C-C motif chemokine 24; CCL24; CCL24_HUMAN; Chemokine CC Motif Ligand 24; CK beta 6; CK-beta-6; Ckb6; Eosinophil chemotactic protein 2; Eotaxin-2; MPIF 2; MPIF-2; MPIF2; Myeloid progenitor inhibitory factor 2; SCYA24; Small inducible cytokine A24; Small inducible cytokine subfamily A (Cys-Cys) member 24 ; Small-inducible cytokine A24
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Expression Range 27-119aa
Protein Length Full Length of Mature Protein
Mol. Weight 14.5kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.
Subcellular Location Secreted.
Protein Families Intercrine beta (chemokine CC) family
Database References
Tissue Specificity Activated monocytes and activated T lymphocytes.

Gene Functions References

  1. Study showed that CCL24 was upregulated in hepatocellular carcinoma (HCC) tissues and correlated with poor prognosis in HCC patients . Also, CCL24 was associated with the metastatic potential of HCC cell lines and promoted proliferation, migration, and invasion. PMID: 28042950
  2. Mean eotaxin 2 concentrations in nasal fluid in patients with perennial allergic rhinitis and nonallergic and allergic chronic rhinosinusitis with nasal polyps patients were significantly higher in comparison to control subjects. PMID: 28587510
  3. HMGB1 did not elicit chemotaxis of human eosinophils alone and had no effect in combination with the eosinophil chemotactic agent, eotaxin-2 (CCL24). PMID: 25774667
  4. these data suggest that CCL26 and CCL24 are likely involved in the pathogenesis of chronic nasal hypereosinophilia, with a complex cooperation and different involvement of the various members of eotaxin family. PMID: 24989688
  5. Pregnancy associated environments increased local CCL24/CCR3, supporting the process of decidualization in human early pregnancy. PMID: 23696919
  6. Phosphodiesterase 4 inhibitors, rolipram and RO-20-1724 have no effect on CCL24 expression in human primary bronchial epithelial cells. PMID: 22946025
  7. Study shows that CCL24 levels were significantly increased in age-related macular degeneration (AMD) patients despite Avastin treatment as compared with normal controls and those without Avastin. PMID: 23025269
  8. CCR3 is differentially expressed on inflammatory cells in rheumatoid arthritis, while eotaxin-2, a potent CCR3 agonist, is differentially expressed in active disease. PMID: 20659406
  9. stimulates lung fibroblast proliferation and collagen synthesis PMID: 20143648
  10. alters eosinophil integrin function via mitogen-activated protein kinases PMID: 12034562
  11. Intradermal injection of CCL24 induces recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions in atopic and nonatopic volunteers. PMID: 12193745
  12. Plasma eotaxin-2 concentrations differed in asthmatic patients with respect to aspirin intolerance and tolerance, indicating that eotaxin-2 may be differentially up-regulated according to aspirin intolerance. PMID: 16304252
  13. Our results suggest that Eo2 +179T>C and Eo2 +275C>T of eotaxin-2 might be associated with the susceptibility of ulcerative colitis. PMID: 16391516
  14. These data support the idea that CCL24/eotaxin-2 is part of the mechanism of CD4 lymphocyte activation paracrinally induced by Nef. PMID: 17630924
  15. eotaxin-2 is a chemokine strongly associated with primary and metastatic tumors of colorectal origin PMID: 17908961
  16. the ability to produce eotaxin-2/CCL24 is acquired during the differentiation into eosinophilic lineage which is dependent on GATA-1 expression PMID: 17917245
  17. This protein is an eosinophil chemoattractant that is up-regulated by human rhinovirus infection in cultured bronchial epithelial cells. PMID: 11467997

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed