Recombinant Human C-C Motif Chemokine 25 (CCL25) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10042P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 25 (CCL25) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10042P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human C-C Motif Chemokine 25 (CCL25) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O15444 |
Target Symbol | CCL25 |
Synonyms | A130072A22Rik; C-C motif chemokine 25; CCL 25; CCL25; CCL25_HUMAN; Chemokine (C C motif) ligand 25; Chemokine (CC motif) ligand 25; Chemokine C C motif ligand 25; Chemokine CC motif ligand 25; Chemokine TECK; Ck beta 15; Ckb 15; Ckb15; MGC125074; MGC150327; SCY A25; SCYA 25; SCYA25; Small inducible cytokine A25; Small inducible cytokine A25 isoform 1 precursor; Small inducible cytokine A25 isoform 2 precursor; Small inducible cytokine subfamily A (Cys Cys) member 25; Small inducible cytokine subfamily A Cys Cys member 25; Small inducible cytokine subfamily A; member 25; Small-inducible cytokine A25; TECK; TECKvar; Thymus expressed chemokine; Thymus-expressed chemokine |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL |
Expression Range | 24-150aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 41.2kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References | |
Tissue Specificity | Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine. |
Gene Functions References
- CCL25 was able to induce proteoglycan and collagen type I production in anulus fibrosus-derived cells. PMID: 30060561
- It plays a pathogenic role in liver diseases and it will be a therapeutic target of the diseases. PMID: 27795503
- TECK was shown to be expressed by osteoblasts, and its receptor, CCR9, by osteoclast precursors. TECK increased P. gingivalis LPS-induced osteoclast numbers in an in vitro osteoclast formation assay using osteoclast precursors. T PMID: 26921718
- that CCL25/CCR9 signal may provide cancer cells with chemotactic abilities through influencing several epithelial-mesenchymal transitionmarkers PMID: 27008282
- CCR9/CCL25 interactions are not only involved in colitis pathogenesis but also correlate with colonic inflammatory burden; further supporting the existence of overlapping mucosal lymphocyte recruitment pathways between the inflamed colon and liver. PMID: 26873648
- CpG methylation is reduced in gingival biopsies of patients with periodontitis PMID: 26472015
- Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis. PMID: 26879872
- CCL25 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group. PMID: 26279399
- CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway. PMID: 25691296
- High CCL25 expression is associated with the pathogenesis of ulcerative colitis. PMID: 24936795
- Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls. PMID: 25296976
- TECK derived from endometrial stromal cell and macrophages upregulates the number and function of Tregs in the ectopic milieu. PMID: 25275597
- CCL25 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249
- CCL25 and CCR9 regulate colorectal cancer progression and invasion. PMID: 22863617
- cell migration assays revealed that mesenchymal stromal cells (MSCs) have tropism toward multiple myeloma (MM) cells, and CCL25 was identified as a major MM cell-produced chemoattractant for MSCs. PMID: 22102554
- We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes. PMID: 21637913
- CCL25 enhanced the expression of MMP-1, -9, -11 and -13 active proteins by BrCa cells in a CCR9-dependent fashion. PMID: 21344163
- CCL25 may be involved in the differentiation of monocytes to macrophages particularly in rheumatoid arthritis PMID: 20738854
- over-expressed TECK interacts with CCR9 on the endometrial stromal cells in the endometriotic milieu, which may contribute to the onset and progression of endometriosis. PMID: 20081876
- demonstrate a unique pattern of regulation for CCL25 and suggest a role for caudal type homeo box proteins in regulating CCL25 transcription PMID: 16517733
- Intracellular signaling required for CCL25-stimulated T cell adhesion mediated by the integrin alpha4beta1. PMID: 17510295
- High expression may explain high incidence of melanoma metastis to the small intestine. PMID: 18245522
- There was a robust migration of specific IgA- and IgM-antibody-secreting cells induced by Salmonella vaccination toward the mucosal chemokines CCL25 and CCL28 PMID: 19003934