Recombinant Human C-C Motif Chemokine 8 (CCL8) Protein (His)

Beta LifeScience SKU/CAT #: BLC-09762P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human C-C Motif Chemokine 8 (CCL8) Protein (His)

Beta LifeScience SKU/CAT #: BLC-09762P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human C-C Motif Chemokine 8 (CCL8) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P80075
Target Symbol CCL8
Synonyms Ccl8; CCL8_HUMAN; HC14; MCP-2; MCP-2(6-76); Monocyte chemoattractant protein 2; Monocyte chemotactic protein 2; SCYA10; SCYA8; Small-inducible cytokine A8
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Expression Range 24-99aa
Protein Length Full Length of Mature Protein
Mol. Weight 10.9kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
Subcellular Location Secreted.
Protein Families Intercrine beta (chemokine CC) family
Database References
Tissue Specificity Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate.

Gene Functions References

  1. It was shown that MCP2 was able to activate the NF-kappaB signaling pathway inducing the epithelial-mesenchymal transition (EMT) and promoting the migration and invasion of ESCC cells in vitro. PMID: 29148603
  2. Transcriptome analysis identified several novel IPF-related genes. Among them, CCL8 is a candidate molecule for the differential diagnosis and prediction of survival. PMID: 28057004
  3. Findings exemplify how gradients of chemoattractive factors such as CCL8, drive metastasis and suggest that interference with their operation may provide means for breast cancer management. PMID: 27181207
  4. Detecting expression changes in TLR4 and MCP2 in the peripheral blood is a feasible method for predicting the occurrence of abortion in women of child-bearing age PMID: 27173235
  5. Dermal fibroblast CCL8 promotes melanoma metastasis. PMID: 26320180
  6. Authors show that the previously observed downregulation of hsa-miR-92a and upregulation of CCL8 during human cytomegalovirus latent infection of myeloid cells are intimately linked via the latency-associated expression of cytomegalovirus UL111A. PMID: 25253336
  7. CCL8 is an antimicrobial protein with bacteriocidal activity against E. coli. PMID: 12949249
  8. Results indicate that the induction of MCP-2/CCL8 by mycobacteria is dependent on the activation of TLR2/PI3K/Akt signaling pathway. PMID: 23418602
  9. Macrophage Colony Stimulating Factor and Monocyte Chemoattractant Protein are elevated in sera of intrinsic asthmatics compared to normal controls. PMID: 21945122
  10. genetic polymorphhism is associated with a risk of death for non-small cell lung cancer in Chinese PMID: 21514686
  11. Cytokine treatment increases mRNA stability only for chemokines CCL2 and CCL8 in airway epithelium, and transient silencing and overexpression of human antigen R affects only chemokine CCL2 and CCL8 expression in primary and transformed epithelial cells. PMID: 21220697
  12. CCL8/MCP-2 is a target for mir-146a in HIV-1 infected microglia, as overexpression of mir-146a prevented HIV-induced secretion of MCP-2 chemokine PMID: 20181935
  13. TRAIL pretreatment of endothelial cells down-modulated mRNA steady-state levels of several TNF-alpha-induced chemokines, and it abrogated the TNF-alpha-mediated up-regulation of CCL8 and CXCL10, modulating leukocyte/endothelial cell adhesion PMID: 15644410
  14. Angiotensin II directly stimulates MCP-2 expression through AT1-receptors in activated macrophages PMID: 17487826
  15. CCL8 is a promising specific serum marker for the early and accurate diagnosis of graft-versus-host disease. PMID: 18256320
  16. A new finding is the differential distribution of CCL8 marker alleles and a haplotype in extreme severity subgroups of MS. PMID: 18602166
  17. IP-10 and MCP-2 are expressed in tuberculosis patients PMID: 18684849
  18. 5-Amino-4-imidazole carboxamide riboside (AICAR) markedly increases UCP-2 expression and reduced both reactive oxygen species and prostacyclin synthase nitration. PMID: 18835932
  19. These data indicate that optimal induction and delivery of MCP-2/CCL8 is counteracted by converting this chemokine into a receptor antagonist, thereby losing its anti-tumoral potential. PMID: 19224633
  20. CCL8/MCP rs1133763 SNP, or other variants in linkage disequilibrium with this variant, likely do not influence the susceptibility to AD or FTLD in Caucasians. PMID: 19415413

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed