Recombinant Human C-X-C Motif Chemokine 2 (CXCL2), Active

Name: Recombinant Human C-X-C Motif Chemokine 2 (CXCL2), Active
Brand: Beta LifeScience
SKU: BLC-05543P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Chemokines and receptors, Cytokines, Cytokines and growth factors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-X-C Motif Chemokine 2 (CXCL2), Active is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 10 ng/mL.
Uniprotkb	P19875
Target Symbol	CXCL2
Synonyms	C-X-C motif chemokine 2; Chemokine (C X C motif) ligand 2; Chemokine; CXC motif; ligand 2; CINC 2a; CINC2a; CINC3; CXC chemokine; CXCL 2; Cxcl2; CXCL2_HUMAN; Cytokine-induced neutrophil chemoattractant 3; GRO 2; GRO b; GRO protein; beta; Gro-beta; GRO-beta(5-73); GRO-beta-T; GRO2; GRO2 oncogene; GROb; GRObeta; Growth regulated protein beta; Growth-regulated protein beta; GROX; Hematopoietic synergistic factor; HSF; Macrophage inflammatory protein 2 alpha; Macrophage inflammatory protein 2; Macrophage inflammatory protein 2-alpha; Melanoma growth stimulatory activity beta; MGSA b; MGSA beta; MIP 2; MIP 2a; MIP2 alpha; MIP2; MIP2-alpha; MIP2A; MIP2alpha; SB-251353; SCYB 2; Scyb; SCYB2; Small inducible cytokine subfamily B; member 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Expression Range	39-107aa
Protein Length	Partial
Mol. Weight	7.67 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 400 mM NaCl, pH 8.5
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	HGNC: 4603 OMIM: 139110 KEGG: hsa:2920 STRING: 9606.ENSP00000427279 UniGene: Hs.75765

Gene Functions References

The studies revealed that, although overall structural and oligomerization features of CXCL3 and CXCL2 are similar, prominent differences were observed in their surface characteristics, thus implicating a functional divergence. PMID: 28928065
Taken together, the data of the present study demonstrated that TcpC can induce MIP2 production, which may contribute to the characteristic histological change associated with pyelonephritis. PMID: 28765918
Functional effects data suggested that recombinant human CXCL2 significantly enhanced the migration, invasion ability of SMMC7721 hepatocellular carcinoma cells, and weakened adhesion ability. PMID: 27117207
Reduced rate of sickle-related complications in Brazilian patients carrying HbF-promoting alleles at the BCL11A and HMIP-2 loci PMID: 26888013
Results identify the CXCL2/MIF-CXCR2 axis as an important mediator in MDSC recruitment and as predictors in bladder cancer. PMID: 27721403
Chronic inflammation contributes to the change of CXCL12 DNA methylation in buccal cells and that DNA methylation profile of CXCL12 promoter plays important role in development and progression of periodontal disease. PMID: 27580404
high GRO-beta expression correlates with poor prognosis and contributes to ovarian cancer tumorigenesis and metastasis. PMID: 26063953
In this review, a genetic variant in CXCL12 is described that is associated with type 2 diabetes mellitus and its complications. PMID: 25085744
We have demonstrated that GRObeta, as an oncogene product, contributed to tumorigenesis and metastasis of HCC PMID: 25801245
Our results demonstrated that resistance to anti-proliferative effects of CXCR2 may also arise from feedback increases in MIP-2 secretion. PMID: 25682075
autophagy is required for Hepatitis B virus-induced NF-kappaB activation and release of IL-6, IL-8, and CXCL2 in Hepatocytes PMID: 25708728
The results link CXCL1 and CXCL2 chemokines with bone marrow adiposity and implicate CXCR2 signaling in promoting effects of marrow fat on progression of skeletal tumors in bone. PMID: 25802102
CXCL2 has antimicrobial activity against E. coli and S. aureus. PMID: 12949249
Simultaneous targeting of hCAP-G2 and MIP-2A is a promising strategy for the development of antitumor drugs as a treatment for intractable tumours. PMID: 24098805
our results demonstrate the diverse mechanisms by which CXCL2 and CXCL3 mediate normal and asthmatic airway smooth muscle cell migration PMID: 23904157
CXCL12 and CXCR4 are related to formation of gastric tumors and lymph node metastasis PMID: 21630055
Ubiquinol decreases monocytic expression and DNA methylation of the pro-inflammatory CXCL2 gene in humans. PMID: 23021568
CXCL2, a WAT-produced chemokine being up-regulated in obesity, stimulates neutrophil adhesion to vis WAT endothelial cells. Activated neutrophils in obesity may influence vis WAT-ECs functions and contribute to WAT inflammation. PMID: 23372021
This is the first report showing the role of CXCL2 in cancer-associated bone destruction. PMID: 22771802
Anti-human ANXA1 antibodies and, to a lesser extent, anti-human ANXA4 antibodies increased MIP-2 or IL-8 production. PMID: 22056994
Data suggest that GRObeta may function as an oncogene product and contribute to tumorigenesis and metastasis of esophageal squamous cell carcinoma. PMID: 21677836
It can be hypothesized that for some targets, such as CXCL1 and CXCL2, additional signaling may be necessary to fully activate the 3'untranslated region-dependent human antigen R (HuR) function in airway epithelium PMID: 21220697
A significantly increased expression of GRO-2, GRO-3, and IL-8 in colon carcinoma as compared to normal tissue, is reported. PMID: 20162422
G-CSF stimulates the expression of the MIP-2 receptor via STAT3-dependent transcriptional activation of Il8rb PMID: 20185584
modulation of the GRO beta concentration in the endometrium by inflammatory mediators may contribute to the normal and pathological processes of human reproduction by regulating the trafficking of neutrophils into the endometrium PMID: 12892904
Neutrophil elastase, MIP-2, and TLR-4 have roles in progression of human sepsis and murine peritonitis PMID: 15614130
CXCL2 tandem repeat promoter polymorphism is associated with susceptibiltiy to severe sepsis in the Spanish population. PMID: 16421598
CXC chemokine CXCL10 and CC chemokine CCL2 serum levels increase with normal aging PMID: 16697212
Inhibition of ERK phosphorylation decreased expression of Grob. PMID: 17466952
data suggest that a tandem repeat polymorphism (AC)n at position -665 in the CXCL2 gene may be an independent predictor of mortality for severe sepsis PMID: 17944017
Decrease of CXCL1 and -2 mediated by Curcumin is involved in the inhibition of metastasis in breast cancer cells. PMID: 17999991
Peripheral neutrophilia and increased serum chemokines (IL-8 and MIP-2) may indicate hepatic injuries in glycogen storage disease type Ia. PMID: 18191274
Resident tissue macrophages are the major source of MIP-2 and KC chemokines; these chemokines are newly synthesized products of signaling through Toll-like receptors. PMID: 18322244
In colon epithelial cells, induction of MIP-2 alpha expression by tumor necrosis factor-alpha was accompanied by a concomitant reduction in miR-192 expression and miR-192 was observed to regulate the expression of MIP-2 alpha. PMID: 18835392
Report gonadotropin-releasing hormone-regulated CXCL2 expression in human placentation. PMID: 19369450

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.