Recombinant Human C-X-C Motif Chemokine 3 (CXCL3) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08354P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human C-X-C Motif Chemokine 3 (CXCL3) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08354P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description Recombinant Human C-X-C Motif Chemokine 3 (CXCL3) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P19876
Target Symbol CXCL3
Synonyms C-X-C motif chemokine 3; C-X-C motif chemokine ligand 3; Chemokine (C X C motif) ligand 3; Chemokine (CXC motif) ligand 3; Cinc 2; CINC 2b; Cinc2; CINC2b; CXCL 3; Cxcl3; CXCL3_HUMAN; Cytokine induced neutrophil chemoattractant 2; Dcip1; Dendritic cell inflammatory protein 1; Gm1960; GRO protein gamma; GRO-gamma; GRO-gamma(1-73); GRO-gamma(5-73); GRO3; GRO3 oncogene; GROG; Growth regulated protein gamma; Growth-regulated protein gamma; Macrophage inflammatory protein 2 beta precursor ; Macrophage inflammatory protein 2-beta; Melanoma growth stimulatory activity gamma; Member 3; MGSA gamma; MIP 2b; MIP2-beta; MIP2B; SCYB3; Small inducible cytokine subfamily B
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Expression Range 35-107aa
Protein Length Full Length of Mature Protein
Mol. Weight 11.9kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
Subcellular Location Secreted.
Protein Families Intercrine alpha (chemokine CxC) family
Database References

Gene Functions References

  1. CXCL3 exerts its carcinogenic potential by directly and/or indirectly regulating the downstream signaling pathways and the expression of transcription factors in PCa. PMID: 29524043
  2. Exogenous CXCL3 induced Erk1/2 and ETS1 phosphorylation and promoted CD133 expression. PMID: 27255419
  3. Our findings suggest that CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis. PMID: 26837773
  4. results support a functional role of CXCL3 in breast cancer metastasis and as a viable target for cancer therapy PMID: 24605943
  5. CXCL3 displays antimicrobial activity against E. coli and S. aureus. PMID: 12949249
  6. secreted growth-regulated oncogene chemokines, specifically GRO-gamma, in human Mesenchymal stromal cell-conditioned media have an effect on the differentiation and the function of human monocyte-derived dendritic cells. PMID: 23589610
  7. Data show that mesenchymal stem cells (MSCs) directly regulate T cell proliferation by induction of CXCL3 chemokine and its receptor, CXCR2 on the surface in T cells. PMID: 23023221
  8. demonstrates, for the first time, that BIRC3 (anti-apoptotic protein), COL3A1 (matrix protein synthesis), and CXCL3 (chemokine) were up-regulated in the thrombin-stimulated human umbilical vein endothelial cells PMID: 16356540
  9. GRO-gamma is a promising candidate for Th2-associated glomerular permeability factor in minimal change disease. PMID: 17389786
  10. Inhibition of ERK phosphorylation decreased expression of GRO3. PMID: 17466952
  11. Report gonadotropin-releasing hormone-regulated CXCL3 expression in human placentation. PMID: 19369450
  12. propose that chemokines belonging to the CXC family could play an important role in the etiology of tendon xanthoma (TX), with CXCL3 being a possible biological marker of onset and development of TX PMID: 19448742
  13. overexpression of CXCL13 in the intestine during inflammatory conditions favors mobilization of B cells and of LTi and NK cells with immunomodulatory and reparative functions. PMID: 19741597

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed