Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) Protein (His-SUMO)

Name: Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02868P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P31997
Target Symbol	CEACAM8
Synonyms	Carcinoembryonic antigen CGM6; Carcinoembryonic antigen gene family member 6; Carcinoembryonic antigen related cell adhesion molecule 8; Carcinoembryonic antigen-related cell adhesion molecule 8; CD 66b; CD 67; CD66b; CD66b antigen; CD67; CD67 antigen; CEACAM 8; CEACAM8; CEAM8_HUMAN; CGM 6; CGM6; NCA 95; NCA95; Non-specific cross-reacting antigen NCA-95; Nonspecific cross reacting antigen NCA 95; Nonspecific cross reacting antigen NCA95
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Expression Range	35-320aa
Protein Length	Full Length of Mature Protein
Mol. Weight	47.5kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor. Cell surface.
Protein Families	Immunoglobulin superfamily, CEA family
Database References	HGNC: 1820 OMIM: 615747 KEGG: hsa:1088 STRING: 9606.ENSP00000244336 UniGene: Hs.41
Tissue Specificity	Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.

Gene Functions References

Increased CD66b positive tumor-infiltrating neutrophils (CD66b + TINs) was significantly associated with presence of metastasis, S stage, and nonseminomatous germ cell tumor diagnosis. PMID: 27863478
Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID: 26483485
Granulocytes from type 2 diabetes patients display higher granulocyte cell surface expression of CD66b compared with values of healthy controls. PMID: 23686079
The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID: 21470677
All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes. PMID: 17909799
CD66b molecules are involved in regulating adhesion and activation of eosinophils, possibly through their localization in lipid rafts and interaction with other cell surface molecules, such as CD11b. PMID: 18056392

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.